Result : Q67PR8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AP006840.1 |
| Organism | Symbiobacterium thermophilum (strain T / IAM 14863) |
| Left | 1485391 |
| Right | 1485600 |
| Strand | + |
| Nucleotide Sequence | ATGATCAAGCCGTCTCTTGACCAGCTGATGCATCTCGTCGATTCCAAGTACACGCTGGTCATCCTGGCGGCCCGCCGGGCGCGGGACCTGCAGGATGGCAAGCACCAGATGGTGGAATCGAAGTCCAATAAACCCGTGACGATTGCCCTGGAGGAGTTGGCGGCCGGCAAGCTCTTCTTCGAGCGCGGCAAGCCGACCCCCCTGGGCTGA |
| Sequence | MIKPSLDQLMHLVDSKYTLVILAARRARDLQDGKHQMVESKSNKPVTIALEELAAGKLFFERGKPTPLG |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 15383646 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q67PR8 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 82
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1485391 | 1485600 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 2 | 2150370 | 2150576 | - | NZ_CP036259.1 | Sporomusa termitida |
| 3 | 4044498 | 4044704 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 4 | 1294695 | 1294901 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 5 | 2972837 | 2973043 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 6 | 2259754 | 2259960 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 7 | 3393606 | 3393812 | + | NZ_CP021434.1 | Tumebacillus avium |
| 8 | 1112365 | 1112535 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 9 | 1790295 | 1790501 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 10 | 1789824 | 1790003 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 11 | 1508805 | 1509014 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 12 | 79109 | 79315 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 13 | 1226362 | 1226577 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 14 | 1165395 | 1165607 | - | NZ_LR134375.1 | Veillonella dispar |
| 15 | 1525171 | 1525371 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 16 | 2131808 | 2132017 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 17 | 1005599 | 1005805 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 18 | 1770415 | 1770615 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 19 | 1107260 | 1107472 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 20 | 1210192 | 1210404 | - | NZ_LR778174.1 | Veillonella parvula |
| 21 | 1820926 | 1821129 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 22 | 1549964 | 1550167 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 23 | 1646645 | 1646848 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 24 | 1609107 | 1609310 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 25 | 1615437 | 1615640 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 26 | 343373 | 343576 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 27 | 1642567 | 1642770 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 28 | 1071214 | 1071402 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 29 | 1661282 | 1661494 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 30 | 154653 | 154856 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 31 | 2363652 | 2363855 | - | NZ_CP011937.1 | Bacillus velezensis |
| 32 | 1597291 | 1597494 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 33 | 1796080 | 1796289 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 34 | 1770980 | 1771180 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 35 | 1748378 | 1748578 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 36 | 1545775 | 1545966 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 37 | 1544613 | 1544816 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 38 | 3774362 | 3774565 | - | NZ_CP043404.1 | Bacillus safensis |
| 39 | 844316 | 844519 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 40 | 677653 | 677829 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 41 | 4434300 | 4434515 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 42 | 1525910 | 1526089 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 43 | 2146289 | 2146495 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 44 | 2340956 | 2341159 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 45 | 1476509 | 1476682 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 46 | 2796438 | 2796644 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 47 | 1859676 | 1859882 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 48 | 4127981 | 4128187 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 49 | 593477 | 593665 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 50 | 3946079 | 3946264 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 51 | 3940617 | 3940829 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 52 | 331754 | 331951 | + | NZ_LT996885.1 | Dialister massiliensis |
| 53 | 3336406 | 3336612 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 54 | 1590837 | 1591049 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 55 | 1394823 | 1395017 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 56 | 3853622 | 3853834 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 57 | 1638749 | 1638958 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 58 | 2999902 | 3000126 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 59 | 1016947 | 1017144 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 60 | 4941252 | 4941458 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 61 | 1624572 | 1624781 | - | NZ_CP034118.1 | Staphylospora marina |
| 62 | 2353263 | 2353433 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 63 | 107318 | 107524 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 64 | 1582314 | 1582499 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 65 | 1888412 | 1888615 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 66 | 1763893 | 1764087 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 67 | 1188301 | 1188501 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 68 | 274179 | 274379 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 69 | 2794404 | 2794604 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 70 | 636150 | 636350 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 71 | 2603749 | 2603958 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 72 | 586483 | 586683 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 73 | 2185099 | 2185299 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 74 | 1401133 | 1401336 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 75 | 1533045 | 1533248 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 76 | 2075105 | 2075329 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 77 | 1387550 | 1387765 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 78 | 2274012 | 2274227 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 79 | 1062339 | 1062545 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 80 | 1344722 | 1344931 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 81 | 1010059 | 1010268 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 82 | 1432859 | 1433053 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 83 | 1825293 | 1825487 | - | NZ_CP024955.1 | Kyrpidia spormannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006177.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03755.15 | 0.91 | 75 | 952 | same-strand | YicC-like family, N-terminal region |
| 2 | PF08340.13 | 0.91 | 75 | 952 | same-strand | Domain of unknown function (DUF1732) |
| 3 | PF04025.14 | 0.9 | 74 | 632.0 | same-strand | Domain of unknown function (DUF370) |
| 4 | PF00625.23 | 0.95 | 78 | 3.0 | same-strand | Guanylate kinase |
| 5 | PF13238.8 | 0.67 | 55 | 4 | same-strand | AAA domain |
| 6 | PF04127.17 | 0.98 | 80 | 54.5 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.98 | 80 | 54.5 | same-strand | Flavoprotein |
| 8 | PF18074.3 | 0.8 | 66 | 1299.0 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF17764.3 | 0.82 | 67 | 1299 | same-strand | 3'DNA-binding domain (3'BD) |
| 10 | PF00270.31 | 0.82 | 67 | 1299.0 | same-strand | DEAD/DEAH box helicase |
| 11 | PF04851.17 | 0.8 | 66 | 1299 | same-strand | Type III restriction enzyme, res subunit |
| 12 | PF18319.3 | 0.82 | 67 | 1299 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 13 | PF01327.23 | 0.71 | 58 | 3743.0 | same-strand | Polypeptide deformylase |
| 14 | PF00551.21 | 0.74 | 61 | 4230 | same-strand | Formyl transferase |
| 15 | PF02911.20 | 0.74 | 61 | 4230 | same-strand | Formyl transferase, C-terminal domain |
++ More..