ProsmORF-pred
Result : Q67PG5
Protein Information
Information Type Description
Protein name 50S ribosomal protein L32
NCBI Accession ID AP006840.1
Organism Symbiobacterium thermophilum (strain T / IAM 14863)
Left 1586935
Right 1587129
Strand +
Nucleotide Sequence ATGGCGGTTCCGAAGAGAAAGGTGTCCAAGTCCCGTAGGGACTCCCGGCGGGCCCAGACCTTCCGCCTTGAGGCGCCGAACCTGAGCCCGTGCCCGAATTGCCGGACGCCCAGGCTTCCGCACCGGGTCTGCCCCAACTGTGGCTACTACCAGGGCCGGGTCGTGATCCAGCACGAGGCCGAAGCTGCCGAGTAG
Sequence MAVPKRKVSKSRRDSRRAQTFRLEAPNLSPCPNCRTPRLPHRVCPNCGYYQGRVVIQHEAEAAE
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Pubmed ID 15383646
Domain CDD:415589
Functional Category Ribosomal_protein
Uniprot ID Q67PG5
ORF Length (Amino Acid) 64
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 413
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1586935 1587129 + NC_006177.1 Symbiobacterium thermophilum IAM 14863
2 1333899 1334081 - NC_014209.1 Thermoanaerobacter mathranii subsp. mathranii str. A3
3 1312099 1312281 - NC_013921.1 Thermoanaerobacter italicus Ab9
4 1127728 1127907 - NZ_CP068564.1 Keratinibaculum paraultunense
5 1414305 1414487 - NC_008593.1 Clostridium novyi NT
6 1269641 1269823 + NZ_CP025286.1 Ethanoligenens harbinense YUAN-3
7 2873184 2873366 + NC_011979.1 Geobacter daltonii FRC-32
8 2393360 2393542 - NC_014833.1 Ruminococcus albus 7 = DSM 20455
9 1804594 1804776 + NZ_CP048649.1 Aminipila butyrica
10 964064 964240 + NZ_CP036523.1 Peptacetobacter hiranonis
11 32541 32723 + NZ_HF545617.1 Ruminococcus bicirculans
12 1900192 1900371 - NC_015437.1 Selenomonas sputigena ATCC 35185
13 1044416 1044598 + NZ_LT906477.1 Clostridium cochlearium
14 1681429 1681605 + NC_007498.2 Syntrophotalea carbinolica DSM 2380
15 523933 524115 + NZ_CP027228.1 Mogibacterium diversum
16 318117 318296 - NZ_CP017269.1 Geosporobacter ferrireducens
17 896379 896558 + NZ_CP030777.1 Faecalibacterium prausnitzii
18 1206868 1207050 - NZ_LT632322.1 Murdochiella vaginalis
19 4250446 4250622 - NZ_AP018449.1 Methylomusa anaerophila
20 78824 79015 + NC_015682.1 Thermodesulfobacterium geofontis OPF15
21 2406616 2406798 - NZ_CP040098.1 Desulfoglaeba alkanexedens ALDC
22 1153792 1153971 + NC_014831.1 Thermaerobacter marianensis DSM 12885
23 1704635 1704817 + NC_008554.1 Syntrophobacter fumaroxidans MPOB
24 2175466 2175648 + NC_009483.1 Geobacter uraniireducens Rf4
25 1257525 1257704 + NZ_AP019004.1 Phascolarctobacterium faecium
26 1323746 1323928 - NC_014964.1 Thermoanaerobacter brockii subsp. finnii Ako-1
27 2915979 2916164 - NZ_CP015756.1 Clostridium estertheticum subsp. estertheticum
28 1901972 1902148 + NZ_CP036259.1 Sporomusa termitida
29 1894745 1894927 + NC_015687.1 Clostridium acetobutylicum DSM 1731
30 137691 137873 + NZ_CP008796.1 Thermodesulfobacterium commune DSM 2178
31 1372908 1373087 - NZ_LT906446.1 Megamonas hypermegale
32 1275152 1275334 + NZ_AP023213.1 Citrifermentans bremense
33 1435564 1435746 - NC_015958.1 Thermoanaerobacter wiegelii Rt8.B1
34 1457822 1458007 + NZ_CP007514.1 Rubrobacter radiotolerans
35 2777768 2777947 - NC_009633.1 Alkaliphilus metalliredigens QYMF
36 3597790 3597972 - NC_011146.1 Citrifermentans bemidjiense Bem
37 1833992 1834174 + NZ_CP040924.1 Clostridium thermarum
38 2065775 2065960 - NC_010814.1 Geobacter lovleyi SZ
39 3615195 3615380 + NZ_CP012395.1 Clostridium autoethanogenum DSM 10061
40 1379139 1379324 + NC_014328.1 Clostridium ljungdahlii DSM 13528
41 768359 768547 + NZ_LR134523.1 Peptoniphilus ivorii
42 7257131 7257313 - NZ_CP061800.1 Desulfonema magnum
43 1367078 1367257 + NZ_CP067016.1 Anaerococcus obesiensis
44 752159 752338 + NZ_CP066014.1 Anaerococcus vaginalis
45 2780422 2780598 - NZ_CP019870.1 Clostridioides difficile
46 1751670 1751852 + NC_002939.5 Geobacter sulfurreducens PCA
47 3105720 3105902 - NZ_CP014176.1 Clostridium argentinense
48 1043854 1044036 - NZ_LR134524.1 Peptoniphilus harei
49 1548425 1548607 - NC_013740.1 Acidaminococcus fermentans DSM 20731
50 739028 739213 + NC_017161.1 Hydrogenobacter thermophilus TK-6
51 1170976 1171155 + NZ_CP035130.1 Gudongella oleilytica
52 1786985 1787185 - NC_015520.1 Mahella australiensis 50-1 BON
53 1497414 1497596 - NZ_LR590481.1 Hathewaya histolytica
54 1182796 1182978 + NZ_CP032416.1 Clostridium fermenticellae
55 1449538 1449714 - NC_003869.1 Caldanaerobacter subterraneus subsp. tengcongensis MB4
56 813582 813761 + NC_020134.1 Thermoclostridium stercorarium subsp. stercorarium DSM 8532
57 875114 875293 - NC_014926.1 Thermovibrio ammonificans HB-1
58 1364049 1364225 - NZ_LR778174.1 Veillonella parvula
59 1140408 1140590 - NZ_CP014872.1 Fructilactobacillus lindneri
60 1252230 1252406 - NZ_AP022321.1 Veillonella nakazawae
61 1305974 1306150 - NZ_LR134375.1 Veillonella dispar
62 797570 797746 + NZ_LT906470.1 Veillonella rodentium
63 845128 845313 + NC_013894.1 Thermocrinis albus DSM 14484
64 1031502 1031684 + NC_014377.1 Thermosediminibacter oceani DSM 16646
65 402507 402686 + NZ_CP015519.1 Syntrophotalea acetylenivorans
66 1419168 1419353 - NZ_CP026328.2 Acidithiobacillus caldus
67 695115 695303 + NZ_CP029256.1 Christensenella minuta
68 1184675 1184857 + NZ_CP007452.1 Peptoclostridium acidaminophilum DSM 3953
69 782745 782927 - NZ_LT635480.1 Ndongobacter massiliensis
70 1483349 1483537 - NC_015519.1 Tepidanaerobacter acetatoxydans Re1
71 2537671 2537853 - NZ_CP028842.1 Clostridium botulinum
72 2800041 2800223 - NZ_CP011663.1 Clostridium sporogenes
73 406708 406887 - NZ_CP053988.1 Abiotrophia defectiva
74 1873945 1874130 + NC_008609.1 Pelobacter propionicus DSM 2379
75 1052967 1053140 + NZ_CP016379.1 Anoxybacter fermentans
76 1300986 1301162 - NC_007503.1 Carboxydothermus hydrogenoformans Z-2901
77 1961100 1961303 + NC_016048.1 Oscillibacter valericigenes Sjm18-20
78 1716330 1716509 - NC_018664.1 Gottschalkia acidurici 9a
79 2951180 2951356 - NZ_CP014150.1 Paeniclostridium sordellii
80 621077 621259 + NZ_CP045563.1 Fructilactobacillus sanfranciscensis
81 1362718 1362906 - NZ_AP013035.1 Thermosulfidibacter takaii ABI70S6
82 1817447 1817629 - NZ_CP014170.1 Clostridium tyrobutyricum
83 1798827 1799009 + NC_007517.1 Geobacter metallireducens GS-15
84 2774579 2774764 + NZ_AP018795.1 Acidithiobacillus ferridurans
85 1661322 1661507 + NC_011761.1 Acidithiobacillus ferrooxidans ATCC 23270
86 1175304 1175486 + NZ_CP020953.1 Clostridium drakei
87 672019 672201 + NZ_CP019981.1 Pediococcus inopinatus
88 1462250 1462426 - NC_012438.1 Sulfurihydrogenibium azorense Az-Fu1
89 1406103 1406282 + NZ_CP014163.1 Aerococcus urinaehominis
90 239050 239232 + NZ_CP042909.1 Thermosulfurimonas marina
91 2285039 2285215 + NZ_CP059066.1 Koleobacter methoxysyntrophicus
92 136577 136759 + NZ_CP011803.1 Clostridium carboxidivorans P7
93 3092726 3092908 - NZ_CP009933.1 Clostridium scatologenes
94 1775742 1775924 + NZ_CP009788.1 Geobacter pickeringii
95 1389351 1389536 + NZ_CP031115.1 Rubrobacter indicoceani
96 1219651 1219836 + NZ_CP040586.1 Furfurilactobacillus rossiae
97 2441976 2442158 - NZ_AP023049.1 Alistipes indistinctus
98 1630966 1631145 + NC_013204.1 Eggerthella lenta DSM 2243
99 1402720 1402905 + NZ_CP007028.1 Thermocrinis ruber
100 1360416 1360607 - NC_013895.2 Mageeibacillus indolicus UPII9-5
101 1557793 1557969 + NC_009922.1 Alkaliphilus oremlandii OhILAs
102 570419 570598 + NZ_CP045562.1 Fructilactobacillus fructivorans
103 1829739 1829921 + NZ_CP012294.1 Pediococcus damnosus
104 1117535 1117717 - NC_016605.1 Pediococcus claussenii ATCC BAA-344
105 750013 750195 + NC_008525.1 Pediococcus pentosaceus ATCC 25745
106 824255 824437 + NZ_CP053421.1 Pediococcus acidilactici
107 1136666 1136842 + NC_014657.1 Caldicellulosiruptor owensensis OL
108 707314 707490 + NC_015949.1 Caldicellulosiruptor lactoaceticus 6A
109 1498608 1498784 - NC_014652.1 Caldicellulosiruptor hydrothermalis 108
110 1295284 1295460 + NC_014721.1 Caldicellulosiruptor kristjanssonii I77R1B
111 1614739 1614915 - NC_014720.1 Caldicellulosiruptor kronotskyensis 2002
112 1349830 1350006 + NC_012034.1 Caldicellulosiruptor bescii DSM 6725
113 3061365 3061565 + NZ_CP042430.1 Baekduia soli
114 1325807 1325986 - NZ_CP009170.1 Thermoanaerobacter kivui
115 1113778 1113951 + NC_011899.1 Halothermothrix orenii H 168
116 1379887 1380069 + NZ_AP017470.1 Thermotomaculum hydrothermale
117 815410 815601 - NC_015387.1 Marinithermus hydrothermalis DSM 14884
118 2269818 2270000 - NZ_CP010028.1 Deinococcus radiopugnans
119 2088631 2088816 - NZ_HG917868.1 Clostridium bornimense
120 1670019 1670201 + NZ_CP010311.1 Geoalkalibacter subterraneus
121 187141 187332 - NC_011059.1 Prosthecochloris aestuarii DSM 271
122 1647166 1647345 - NZ_LT635772.1 Anaerococcus mediterraneensis
123 4827568 4827741 - NZ_CP026520.1 Paenibacillus chitinolyticus
124 1009182 1009361 + NZ_CP030105.1 Lactiplantibacillus plantarum
125 1619826 1620005 + NZ_CP032757.1 Lactiplantibacillus pentosus
126 2145973 2146155 - NZ_CP009687.1 Clostridium aceticum
127 3816233 3816412 - NC_018068.1 Desulfosporosinus acidiphilus SJ4
128 2904453 2904632 - NC_016627.1 Acetivibrio clariflavus DSM 19732
129 890727 890909 + NZ_CP017237.1 Moorella thermoacetica
130 47802 47978 + NZ_LR130778.1 Petrocella atlantisensis
131 1375769 1375948 + NZ_CP045851.1 Actinomarinicola tropica
132 1418001 1418177 - NC_014392.1 Caldicellulosiruptor obsidiansis OB47
133 2001719 2001904 - NC_017956.1 Tistrella mobilis KA081020-065
134 2085910 2086083 + NZ_CP020773.1 Staphylococcus lutrae
135 878822 878995 + NC_014925.1 Staphylococcus pseudintermedius HKU10-03
136 1512956 1513132 - NC_014614.1 Acetoanaerobium sticklandii
137 1560680 1560862 - NZ_CP031500.1 Deinococcus radiodurans
138 1968769 1968951 - NC_009828.1 Pseudothermotoga lettingae TMO
139 2003938 2004120 - NC_022792.1 Pseudothermotoga elfii DSM 9442 = NBRC 107921
140 770235 770426 - NC_000918.1 Aquifex aeolicus VF5
141 762505 762687 + NZ_AP014945.1 Caldimicrobium thiodismutans
142 2395242 2395424 - NZ_CP020559.1 Clostridium formicaceticum
143 1812295 1812474 + NZ_CP049740.1 Jeotgalibaca arthritidis
144 1598936 1599109 + NZ_CP027770.1 Staphylococcus felis
145 1843396 1843578 + NZ_CP029494.1 Deinococcus irradiatisoli
146 1052505 1052684 + NZ_CP017267.1 Vagococcus teuberi
147 1018288 1018467 + NZ_CP011402.1 Denitrobacterium detoxificans
148 1556094 1556270 - NZ_CP018180.1 Liquorilactobacillus nagelii
149 2315011 2315190 + NZ_CP034465.1 Jeotgalibaca ciconiae
150 984332 984517 + NZ_CP045571.1 Acidithiobacillus thiooxidans ATCC 19377
151 2501011 2501193 - NC_011898.1 Ruminiclostridium cellulolyticum H10
152 189735 189926 - NC_010803.1 Chlorobium limicola DSM 245
153 2135682 2135864 - NZ_CP019698.1 Desulfotomaculum ferrireducens
154 1483640 1483825 - NZ_CP013988.1 Aerococcus urinaeequi
155 707068 707253 + NZ_CP014164.1 Aerococcus viridans
156 182741 182935 - NZ_CP034413.2 Dysosmobacter welbionis
157 1874669 1874869 + NZ_CP040840.1 Leptospira weilii
158 722697 722879 - NC_012440.1 Persephonella marina EX-H1
159 1455052 1455237 + NC_015942.1 Acidithiobacillus ferrivorans SS3
160 1753959 1754144 + NC_015589.1 Desulfotomaculum ruminis DSM 2154
161 1495256 1495453 + NZ_CP048436.1 Flavonifractor plautii
162 2971550 2971729 - NZ_CP014912.1 Secundilactobacillus paracollinoides
163 1219759 1219935 + NC_018025.1 Desulfomonile tiedjei DSM 6799
164 1299799 1299981 + NZ_AP014510.1 Thermotoga profunda AZM34c06
165 3479123 3479323 + NZ_CP033614.1 Leptospira kmetyi
166 972177 972377 - NZ_CP020414.2 Leptospira interrogans serovar Copenhageni
167 1135739 1135918 - NZ_CP044534.1 Limosilactobacillus frumenti
168 600157 600345 + NC_015436.1 Sphaerochaeta coccoides DSM 17374
169 3587321 3587521 - NZ_CP030142.1 Leptospira mayottensis
170 1102657 1102836 + NC_022567.1 Adlercreutzia equolifaciens DSM 19450
171 163866 164048 - NZ_CP011387.1 Deinococcus puniceus
172 2840264 2840440 - NC_021184.1 Desulfoscipio gibsoniae DSM 7213
173 1310958 1311131 + NZ_CP021850.1 Pseudoclostridium thermosuccinogenes
174 2179174 2179359 - NZ_CP007451.1 Draconibacterium orientale
175 2863756 2863956 - NZ_CP026671.1 Leptospira borgpetersenii serovar Ceylonica
176 3382287 3382469 + NZ_AP021874.1 Desulfosarcina alkanivorans
177 1471418 1471594 - NZ_CP034791.1 Caldicellulosiruptor changbaiensis
178 1968030 1968206 + NC_009437.1 Caldicellulosiruptor saccharolyticus DSM 8903
179 1147125 1147304 - NZ_CP045530.1 Limosilactobacillus pontis
180 1804192 1804368 - NZ_CP024955.1 Kyrpidia spormannii
181 1206918 1207097 - NZ_CP045240.1 Limosilactobacillus vaginalis
182 2275113 2275295 - NC_009253.1 Desulfotomaculum reducens MI-1
183 245826 246008 - NZ_CP013910.1 Deinococcus actinosclerus
184 2505426 2505605 - NC_016894.1 Acetobacterium woodii DSM 1030
185 2605864 2606046 + NC_014212.1 Meiothermus silvanus DSM 9946
186 630431 630619 + NZ_CP014161.1 Aerococcus urinae
187 1178578 1178751 + NZ_CP033460.1 Staphylococcus debuckii
188 1776610 1776798 - NZ_CP017713.1 Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001
189 2190921 2191100 - NZ_CP010802.1 Desulfuromonas soudanensis
190 147710 147901 - NC_007512.1 Pelodictyon luteolum DSM 273
191 1124011 1124193 - NC_019793.1 Deinococcus peraridilitoris DSM 19664
192 997839 998018 - NZ_AP019367.1 Parolsenella catena
193 569602 569784 - NZ_CP010822.1 Thermus aquaticus Y51MC23
194 2049283 2049465 - NZ_CP011389.1 Deinococcus soli (ex Cha et al. 2016)
195 926536 926715 + NZ_AP014680.1 Paucilactobacillus hokkaidonensis JCM 18461
196 2641561 2641740 - NC_014365.1 Desulfarculus baarsii DSM 2075
197 620203 620385 - NC_019386.1 Thermus oshimai JL-2
198 2386203 2386385 - NZ_CP038452.1 Thermus caldilimi
199 883342 883521 + NZ_LT635455.1 Olsenella timonensis
200 623339 623524 + NZ_CP011801.1 Nitrospira moscoviensis
201 1204701 1204889 - NC_023065.1 Magnetospirillum gryphiswaldense MSR-1 v2
202 1453976 1454152 + NC_014098.1 Kyrpidia tusciae DSM 2912
203 3071019 3071201 + NC_017790.1 Deinococcus gobiensis I-0
204 6400738 6400911 - NC_017672.3 Paenibacillus mucilaginosus K02
205 725284 725457 + NZ_CP045927.1 Staphylococcus agnetis
206 1788692 1788865 - NZ_CP008747.1 Staphylococcus hyicus
207 1200984 1201172 + NZ_CP031518.1 Treponema ruminis
208 396721 396903 - NC_006461.1 Thermus thermophilus HB8
209 3136957 3137145 + NZ_CP035807.1 Thiospirochaeta perfilievii
210 2557118 2557300 + NC_007626.1 Magnetospirillum magneticum AMB-1
211 1686010 1686195 + NZ_LT828648.1 Nitrospira japonica
212 3925484 3925678 - NC_013739.1 Conexibacter woesei DSM 14684
213 5381 5569 - NZ_CP012033.1 Levilactobacillus koreensis
214 13862 14044 + NC_008025.1 Deinococcus geothermalis DSM 11300
215 1421752 1421934 - NC_015555.1 Thermoanaerobacterium xylanolyticum LX-11
216 1498647 1498829 - NZ_CP047602.1 Thermoanaerobacterium aotearoense
217 1959631 1959828 - NC_017079.1 Caldilinea aerophila DSM 14535 = NBRC 104270
218 2534925 2535104 - NC_009943.1 Desulfococcus oleovorans Hxd3
219 3036211 3036399 + NC_014221.1 Truepera radiovictrix DSM 17093
220 2870716 2870895 + NC_018178.1 Melioribacter roseus P3M-2
221 4998737 4998922 - NZ_CP055156.1 Adhaeribacter swui
222 1785592 1785777 - NZ_CP055153.1 Adhaeribacter radiodurans
223 1579642 1579809 + NZ_CP014141.1 Thermus parvatiensis
224 1498932 1499114 - NC_014410.1 Thermoanaerobacterium thermosaccharolyticum DSM 571
225 1906456 1906644 - NC_014960.1 Anaerolinea thermophila UNI-1
226 1318504 1318683 - NZ_CP045605.1 Limosilactobacillus reuteri
227 1594787 1594975 - NC_015732.1 Treponema caldarium DSM 7334
228 743797 743970 + NZ_LT906464.1 Staphylococcus muscae
229 913872 914054 + NZ_CP011232.1 Kosmotoga pacifica
230 1112459 1112632 + NZ_LR134304.1 Staphylococcus schweitzeri
231 4796897 4797082 + NZ_CP030265.1 Skermanella pratensis
232 197494 197685 - NC_011060.1 Pelodictyon phaeoclathratiforme BU-1
233 798740 798931 + NC_011297.1 Dictyoglomus thermophilum H-6-12
234 2112666 2112848 + NC_015161.1 Deinococcus proteolyticus MRP
235 922348 922533 - NZ_CP024727.1 Prevotella intermedia
236 1146914 1147090 - NC_016630.1 Filifactor alocis ATCC 35896
237 721994 722170 - NC_016630.1 Filifactor alocis ATCC 35896
238 292378 292560 + NZ_CP021081.1 Deinococcus ficus
239 1150431 1150637 + NZ_CP019937.1 Ketogulonicigenium robustum
240 4228427 4228606 - NC_013757.1 Geodermatophilus obscurus DSM 43160
241 818903 819085 + NC_011653.1 Thermosipho africanus TCF52B
242 652334 652516 + NC_015388.1 Desulfobacca acetoxidans DSM 11109
243 1215056 1215235 - NC_015389.1 Coriobacterium glomerans PW2
244 1999192 1999383 + NC_002932.3 Chlorobaculum tepidum TLS
245 151834 152025 - NC_011027.1 Chlorobaculum parvum NCIB 8327
246 2189694 2189885 - NZ_CP059603.1 Levilactobacillus suantsaii
247 4106415 4106603 - NZ_CP018099.1 Caldithrix abyssi DSM 13497
248 2605547 2605738 + NZ_CP017305.1 Chlorobaculum limnaeum
249 1241516 1241692 - NZ_CP034726.1 Acetilactobacillus jinshanensis
250 371238 371417 - NZ_LT635475.1 Ezakiella massiliensis
251 1672606 1672791 - NC_015500.1 Treponema brennaborense DSM 12168
252 7872005 7872187 - NZ_CP036274.1 Anatilimnocola aggregata
253 3204605 3204784 - NZ_CP036250.1 Egicoccus halophilus
254 655988 656170 + NC_014958.1 Deinococcus maricopensis DSM 21211
255 1591605 1591787 - NZ_CP034118.1 Staphylospora marina
256 150096 150278 - NC_012526.1 Deinococcus deserti VCD115
257 2183816 2183989 - NZ_CP048103.1 Kroppenstedtia eburnea
258 723129 723335 + NC_010644.1 Elusimicrobium minutum Pei191
259 7703036 7703236 + NZ_CP042425.1 Limnoglobus roseus
260 2754307 2754480 - NZ_LS483476.1 Lederbergia lentus
261 2092662 2092847 - NZ_CP030840.1 Acidisarcina polymorpha
262 2856026 2856217 + NC_008639.1 Chlorobium phaeobacteroides DSM 266
263 3952769 3952957 - NC_018645.1 Desulfobacula toluolica Tol2
264 2286089 2286268 - NC_017464.1 Ignavibacterium album JCM 16511
265 2873238 2873411 - NZ_CP070511.1 Parageobacillus toebii
266 1709708 1709881 + NZ_CP016622.1 Parageobacillus thermoglucosidasius
267 2580181 2580351 + NZ_CP026363.1 Brevibacillus agri
268 2370650 2370820 + NZ_LR134338.1 Brevibacillus brevis
269 2970929 2971108 - NZ_CP022121.1 Dehalobacterium formicoaceticum
270 1094202 1094369 + NC_014378.1 Acetohalobium arabaticum DSM 5501
271 1977511 1977708 + NZ_CP051131.1 Parasphingopyxis algicola
272 2535783 2535959 - NC_015275.1 Cellulosilyticum lentocellum DSM 5427
273 5877046 5877234 - NZ_CP035758.1 Ktedonosporobacter rubrisoli
274 1023814 1024002 + NZ_LS483405.1 Levilactobacillus brevis
275 2144480 2144671 - NZ_AP018437.1 Pelolinea submarina
276 1136158 1136340 - NC_017059.1 Pararhodospirillum photometricum DSM 122
277 8325979 8326161 - NZ_CP007155.1 Kutzneria albida DSM 43870
278 10899374 10899562 + NZ_CP012333.1 Labilithrix luteola
279 644575 644769 + NC_016024.1 Chloracidobacterium thermophilum B
280 3957482 3957658 - NC_013510.1 Thermomonospora curvata DSM 43183
281 1402114 1402299 + NC_008148.1 Rubrobacter xylanophilus DSM 9941
282 587847 588044 + NC_018024.1 Acetomicrobium mobile DSM 13181
283 895185 895364 - NZ_CP022889.1 Tsuneonella mangrovi
284 7713185 7713367 - NZ_CP042914.1 Roseimaritima ulvae
285 35570 35767 + NZ_CP030356.1 Salinibacter ruber
286 1741032 1741214 + NZ_CP014525.1 Haematospirillum jordaniae
287 2162096 2162275 + NC_010337.2 Heliomicrobium modesticaldum Ice1
288 473145 473324 + NZ_CP009761.1 Parvimonas micra
289 1043147 1043323 + NC_018870.1 Thermacetogenium phaeum DSM 12270
290 2040259 2040438 + NC_008576.1 Magnetococcus marinus MC-1
291 872238 872426 + NC_015714.1 Treponema paraluiscuniculi Cuniculi A
292 790989 791171 + NZ_CP045508.1 Desulfolutivibrio sulfoxidireducens
293 1958454 1958639 - NZ_LR215980.1 Paraprevotella xylaniphila YIT 11841
294 4064257 4064436 - NC_011830.1 Desulfitobacterium hafniense DCB-2
295 453797 453991 - NC_018720.1 Bifidobacterium asteroides PRL2011
296 3654768 3654950 - NZ_AP023367.1 Anaerocolumna cellulosilytica
297 2312369 2312548 - NZ_CP007032.1 Desulfitobacterium metallireducens DSM 15288
298 3629802 3629984 + NZ_CP045504.1 Desulfovibrio sulfodismutans DSM 3696
299 3328085 3328267 - NZ_CP022464.2 Enterocloster bolteae
300 9086164 9086337 + NZ_AP022870.1 Phytohabitans flavus
301 5652736 5652915 + NZ_AP021861.1 Lacipirellula parvula
302 4964500 4964682 - NZ_CP015235.1 Rhodococcus fascians D188
303 2313017 2313196 - NZ_AP019389.1 Qipengyuania flava
304 2535175 2535354 - NZ_CP031357.1 Erythrobacter aureus
305 2790836 2791042 + NZ_CP019437.1 Thioclava nitratireducens
306 2250311 2250505 - NC_015588.1 Isoptericola variabilis 225
307 1130103 1130282 + NZ_CP046996.1 Dehalobacter restrictus
308 2631019 2631225 + NZ_CP053562.1 Thioclava electrotropha
309 3843228 3843422 - NZ_CP042912.1 Mariniblastus fucicola
310 1203620 1203814 + NZ_LT906453.1 Dermatophilus congolensis
311 156745 156927 + NC_005027.1 Rhodopirellula baltica SH 1
312 1555259 1555438 - NZ_CP011805.1 Pelagerythrobacter marensis
313 3020453 3020635 - NZ_CP042582.1 Hypericibacter adhaerens
314 1787810 1787998 - NC_015681.1 Thermodesulfatator indicus DSM 15286
315 1916199 1916381 + NZ_AP018920.1 Pseudonocardia autotrophica
316 4116117 4116299 - NZ_CP048000.1 Anaerocolumna sedimenticola
317 2131949 2132131 - NZ_CP061007.1 Saccharopolyspora spinosa
318 7924476 7924658 + NZ_CP031142.1 Saccharopolyspora pogona
319 2459327 2459506 + NZ_CP024920.1 Qipengyuania seohaensis
320 1208599 1208778 - NC_015318.1 Hippea maritima DSM 10411
321 851166 851348 + NZ_CP018799.1 Mariprofundus aestuarium
322 264938 265132 - NZ_AP012325.1 Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043
323 311649 311843 - NZ_CP025199.1 Bifidobacterium pseudocatenulatum
324 1173982 1174164 + NZ_CP017057.1 Erythrobacter litoralis
325 1276465 1276644 + NZ_CP015963.1 Altererythrobacter ishigakiensis
326 1432210 1432392 + NC_011837.1 Clostridium kluyveri NBRC 12016
327 3661909 3662094 - NC_011831.1 Chloroflexus aggregans DSM 9485
328 1314913 1315119 - NZ_CP012908.1 Ketogulonicigenium vulgare
329 1593344 1593523 - NZ_CP012669.1 Altererythrobacter epoxidivorans
330 1816550 1816729 + NZ_CP046400.1 Pseudodesulfovibrio cashew
331 1163949 1164155 + NZ_CP045201.1 Pseudopuniceibacterium antarcticum
332 5229953 5230126 + NZ_AP022871.1 Phytohabitans suffuscus
333 1504173 1504355 - NZ_CP018800.1 Mariprofundus ferrinatatus
334 3445807 3445986 - NC_009380.1 Salinispora tropica CNB-440
335 4681865 4682038 + NZ_CP009922.3 Streptomyces xiamenensis
336 442707 442886 - NZ_CP053921.1 Erythrobacter mangrovi
337 2052681 2052863 - NZ_CP016545.1 Paraurantiacibacter namhicola
338 1845472 1845651 - NC_016803.1 Pseudodesulfovibrio mercurii
339 4836705 4836893 + NC_018014.1 Terriglobus roseus DSM 18391
340 4780467 4780640 + NZ_CP054938.1 Streptomyces harbinensis
341 1660735 1660920 + NC_010001.1 Lachnoclostridium phytofermentans ISDg
342 1551855 1552058 + NZ_CP044117.1 Roseomonas mucosa
343 456012 456191 - NC_006055.1 Mesoplasma florum L1
344 503440 503619 - NZ_CP024964.1 Entomoplasma melaleucae
345 512482 512661 - NZ_CP024969.1 Mesoplasma tabanidae
346 472750 472929 - NZ_CP024411.1 Mesoplasma entomophilum
347 501574 501753 - NZ_CP023173.1 Mesoplasma chauliocola
348 1031357 1031542 - NZ_CP036433.1 Lignipirellula cremea
349 10098724 10098906 - NZ_CP012752.1 Kibdelosporangium phytohabitans
350 770862 771068 + NZ_CP051181.1 Thalassobius gelatinovorus
351 1709030 1709215 + NC_016751.1 Marinitoga piezophila KA3
352 3260292 3260489 - NC_013501.1 Rhodothermus marinus DSM 4252
353 779739 779945 + NZ_CP049037.1 Pseudohalocynthiibacter aestuariivivens
354 1990848 1991054 + NZ_CP035510.1 Haematobacter massiliensis
355 1988215 1988421 + NZ_CP034348.1 Roseovarius faecimaris
356 707125 707331 - NZ_CP060436.1 Pseudooceanicola algae
357 1942996 1943202 + NZ_CP010855.1 Marinovum algicola DG 898
358 2979542 2979745 + NZ_LN606600.1 Acetobacter senegalensis
359 1285529 1285726 + NC_015671.1 Cellulomonas gilvus ATCC 13127
360 3566397 3566603 - NZ_CP015093.1 Salipiger abyssi
361 1615903 1616091 + NZ_CP048877.1 Thermosulfuriphilus ammonigenes
362 2061734 2061940 - NZ_CP036289.1 Bremerella volcania
363 3257789 3257968 - NC_014165.1 Thermobispora bispora DSM 43833
364 1927486 1927653 - NZ_AP024085.1 Faecalibacillus intestinalis
365 7911925 7912107 - NC_019673.1 Saccharothrix espanaensis DSM 44229
366 1416340 1416525 + NC_015152.1 Sphaerochaeta globosa str. Buddy
367 2312941 2313123 + NZ_AP023396.1 Nocardia wallacei
368 6866991 6867173 - NZ_CP023445.1 Actinosynnema pretiosum
369 7010385 7010567 - NC_013093.1 Actinosynnema mirum DSM 43827
370 1723039 1723245 - NZ_CP034588.1 Silicimonas algicola
371 128608 128811 - NZ_CP038141.1 Swingsia samuiensis
372 1061168 1061371 - NC_016027.1 Komagataeibacter medellinensis NBRC 3288
373 875448 875651 - NZ_CP019875.1 Komagataeibacter nataicola
374 2298754 2298957 - NZ_CP050139.1 Komagataeibacter rhaeticus
375 1216211 1216414 - NZ_CP036404.1 Komagataeibacter saccharivorans
376 5314990 5315184 - NC_010162.1 Sorangium cellulosum So ce56
377 2146004 2146195 - NZ_CP012836.1 Algoriphagus sanaruensis
378 2361632 2361835 + NZ_CP029176.1 Acidibrevibacterium fodinaquatile
379 1775940 1776098 - NC_008578.1 Acidothermus cellulolyticus 11B
380 9549913 9550095 - NZ_CP034550.1 Saccharothrix syringae
381 540816 541001 - NC_016633.1 Sphaerochaeta pleomorpha str. Grapes
382 2516040 2516219 - NC_007794.1 Novosphingobium aromaticivorans DSM 12444
383 1562645 1562827 + NZ_CP022752.1 Actinopolyspora erythraea
384 4623338 4623517 - NC_014391.1 Micromonospora aurantiaca ATCC 27029
385 1416643 1416834 - NZ_CP043661.1 Kribbella qitaiheensis
386 2471858 2472061 - NZ_CP053708.1 Lichenicola cladoniae
387 4218306 4218494 - NZ_CP036299.1 Planctopirus ephydatiae
388 3339339 3339527 - NC_014148.1 Planctopirus limnophila DSM 3776
389 1425027 1425194 - NC_019978.1 Halobacteroides halobius DSM 5150
390 5263859 5264044 - NZ_CP015136.1 Luteitalea pratensis
391 2132555 2132749 - NC_014330.1 Brachyspira pilosicoli 95/1000
392 1979644 1979838 + NC_014150.1 Brachyspira murdochii DSM 12563
393 5881608 5881796 + NZ_CP022203.1 Corallococcus macrosporus DSM 14697
394 6051119 6051301 - NZ_CP016076.1 Actinoalloteichus fjordicus
395 5973629 5973817 + NC_008095.1 Myxococcus xanthus DK 1622
396 2508259 2508447 - NZ_CP012109.1 Myxococcus hansupus
397 2071186 2071368 + NC_020520.1 Ilumatobacter coccineus YM16-304
398 8810057 8810236 - NC_013595.1 Streptosporangium roseum DSM 43021
399 5544773 5544955 - NZ_CP022521.1 Actinoalloteichus hoggarensis
400 1915478 1915669 + NZ_LT996886.1 Tessaracoccus timonensis
401 1093444 1093626 - NZ_CP036402.1 Egibacter rhizosphaerae
402 3156156 3156344 - NC_006138.1 Desulfotalea psychrophila LSv54
403 2510308 2510490 + NZ_AP023172.1 Rhodococcus qingshengii
404 3509977 3510159 - NZ_CP027793.1 Rhodococcus hoagii
405 2452500 2452682 + NZ_CP022208.1 Rhodococcus pyridinivorans
406 2045963 2046145 + NZ_LT906450.1 Rhodococcus rhodochrous
407 2082810 2082992 + NZ_CP029146.1 Rhodococcus ruber
408 8860251 8860433 + NZ_CP022088.2 Nocardia brasiliensis
409 4333614 4333796 - NC_006361.1 Nocardia farcinica IFM 10152
410 1097461 1097643 - NZ_LS483468.1 Rhodococcus coprophilus
411 2519797 2519979 - NZ_CP048813.1 Rhodococcus triatomae
412 3228071 3228256 - NC_015564.1 Hoyosella subflava DQS3-9A1
413 5735468 5735650 - NZ_LR134352.1 Nocardia asteroides
414 4854969 4855151 - NZ_CP018082.1 Nocardia mangyaensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_006177.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02620.19 0.77 320 30 same-strand Large ribosomal RNA subunit accumulation protein YceD
++ More..