Result : Q67J48
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AP006840.1 |
| Organism | Symbiobacterium thermophilum (strain T / IAM 14863) |
| Left | 3548810 |
| Right | 3549097 |
| Strand | - |
| Nucleotide Sequence | GTGCGGAAGTATGAGATGATGGTGATCGCCCGTCCGGACCTGGATGAGGCGGGGCTTCAGGCCCTGTCCGACAAGATCGCCGAGCTGATCACCAGCAACGGCGGGACGGTCGAGAGCCAGGATGCCTGGAAGAAGCAGCGTCTCGCGTACGAGATCAAGCATCTGCGTGAGGGCTTCTACTCGGTCTTCAACTTCACCGGGGAGCCCCGCACCGCGAACGAGCTGAACCGCGTCCTGAAGATCACCGACGAGGTCGTCCGCTTCCTGATCGTCCGCCCCGCGGAGTAA |
| Sequence | MRKYEMMVIARPDLDEAGLQALSDKIAELITSNGGTVESQDAWKKQRLAYEIKHLREGFYSVFNFTGEPRTANELNRVLKITDEVVRFLIVRPAE |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 15383646 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q67J48 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3548810 | 3549097 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 2 | 3154033 | 3154320 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 3 | 2566251 | 2566538 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 4 | 1916657 | 1916944 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 5 | 3607474 | 3607761 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 6 | 5259579 | 5259866 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 7 | 4253193 | 4253480 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 8 | 5836051 | 5836338 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 9 | 4845384 | 4845671 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 10 | 5347241 | 5347525 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 11 | 3765470 | 3765763 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 12 | 5251072 | 5251356 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 13 | 1896199 | 1896483 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 14 | 7150730 | 7151014 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 15 | 7044939 | 7045223 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 16 | 66038 | 66328 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 17 | 1582166 | 1582450 | - | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 18 | 7903671 | 7903955 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 19 | 5643387 | 5643674 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 20 | 3246272 | 3246556 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 21 | 6796979 | 6797263 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 22 | 8141079 | 8141363 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 23 | 6018769 | 6019053 | - | NZ_CP009288.1 | Paenibacillus durus |
| 24 | 2257031 | 2257315 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 25 | 4005124 | 4005411 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 26 | 8803755 | 8804039 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 27 | 1621518 | 1621802 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019659.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01084.22 | 1.0 | 27 | 566 | same-strand | Ribosomal protein S18 |
| 2 | PF00436.27 | 1.0 | 27 | 44 | same-strand | Single-strand binding protein family |
| 3 | PF06107.13 | 0.81 | 22 | 1009.5 | same-strand | Bacterial protein of unknown function (DUF951) |
| 4 | PF14168.8 | 0.63 | 17 | 220 | opposite-strand | YjzC-like protein |
++ More..