Result : Q662H5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000013.1 |
| Organism | Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) (Borreliella bavariensis) |
| Left | 188669 |
| Right | 188869 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAGTAAGATGAAAACACGCAAAAGTGCAAAAAAAAGGTATTCTTTTACTGTAAATGGCAAAGTTAAGTATAAAAAACAAAATTTAAGACATATTTTGACAAAAAAATCTTCTAAGCGTAAGAGAAATTTAAGGAAATCGGGAAATCTTTCTTGTTTTGAAGTTAAAAGAATTAAAACTTTATTGCCTTATGGTTAA |
| Sequence | MASKMKTRKSAKKRYSFTVNGKVKYKKQNLRHILTKKSSKRKRNLRKSGNLSCFEVKRIKTLLPYG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15547252 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q662H5 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 237
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 188777 | 188977 | - | NZ_CP028861.1 | Borreliella garinii |
| 2 | 190248 | 190448 | - | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 188739 | 188939 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 4 | 188293 | 188496 | - | NZ_CP044535.1 | Borrelia maritima |
| 5 | 187590 | 187778 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 6 | 187514 | 187702 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 7 | 193022 | 193210 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 8 | 200088 | 200276 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 9 | 187867 | 188055 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 10 | 1560150 | 1560338 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 11 | 718842 | 719030 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 12 | 2622051 | 2622242 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 13 | 186491 | 186679 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 14 | 1899606 | 1899797 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 15 | 2771450 | 2771641 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 16 | 3353694 | 3353882 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 17 | 1541152 | 1541343 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 18 | 1073784 | 1073972 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 19 | 2062455 | 2062643 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 20 | 1138744 | 1138935 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 21 | 3016550 | 3016738 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 22 | 1799859 | 1800050 | + | NZ_CP054142.1 | Treponema parvum |
| 23 | 916097 | 916285 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 24 | 1839630 | 1839818 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 25 | 914337 | 914528 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 26 | 938775 | 938963 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 27 | 2139783 | 2139971 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 28 | 2302330 | 2302518 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 29 | 752731 | 752919 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 30 | 1851545 | 1851736 | + | NZ_CP009228.1 | Treponema putidum |
| 31 | 2299284 | 2299478 | - | NZ_CP031518.1 | Treponema ruminis |
| 32 | 2651861 | 2652058 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 33 | 1113794 | 1113985 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 34 | 2190055 | 2190246 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 35 | 2831063 | 2831251 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 36 | 966626 | 966826 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 37 | 1029010 | 1029198 | + | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 38 | 1377270 | 1377467 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 39 | 1323506 | 1323694 | - | NC_023035.1 | Salinispira pacifica |
| 40 | 2385902 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 41 | 1071961 | 1072149 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 42 | 3718874 | 3719062 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 43 | 871988 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 44 | 1883571 | 1883759 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 45 | 542760 | 542948 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 46 | 1525880 | 1526077 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 47 | 1477506 | 1477694 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 48 | 1617613 | 1617801 | - | NZ_CP029256.1 | Christensenella minuta |
| 49 | 1197554 | 1197751 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 50 | 270213 | 270413 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 51 | 2398507 | 2398695 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 52 | 893003 | 893191 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 53 | 798694 | 798882 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 54 | 1891385 | 1891573 | - | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 55 | 4748937 | 4749125 | - | NZ_CP020953.1 | Clostridium drakei |
| 56 | 5157326 | 5157514 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 57 | 666574 | 666762 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 58 | 3924771 | 3924959 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 59 | 644299 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 60 | 3567042 | 3567230 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 61 | 2064737 | 2064925 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 62 | 1791642 | 1791830 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 63 | 1174268 | 1174456 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 64 | 1097767 | 1097955 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 65 | 1385487 | 1385675 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 66 | 456866 | 457054 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 67 | 2311684 | 2311872 | - | NZ_HG917868.1 | Clostridium bornimense |
| 68 | 631690 | 631878 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 69 | 2388455 | 2388643 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 70 | 3389240 | 3389431 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 71 | 2927697 | 2927885 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 72 | 3049662 | 3049850 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 73 | 3208208 | 3208396 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 74 | 3793895 | 3794083 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 75 | 868515 | 868703 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 76 | 1615169 | 1615357 | + | NZ_CP040924.1 | Clostridium thermarum |
| 77 | 800587 | 800775 | + | NZ_CP016786.1 | Clostridium isatidis |
| 78 | 1437079 | 1437267 | - | NZ_CP016786.1 | Clostridium isatidis |
| 79 | 1801048 | 1801236 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 80 | 964803 | 964991 | + | NC_008593.1 | Clostridium novyi NT |
| 81 | 728026 | 728226 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 82 | 1591668 | 1591856 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 83 | 670958 | 671158 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 84 | 1610237 | 1610425 | + | NZ_CP014176.1 | Clostridium argentinense |
| 85 | 1235590 | 1235787 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 86 | 2073743 | 2073928 | - | NZ_LR027382.1 | Alistipes megaguti |
| 87 | 122737 | 122922 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 88 | 922488 | 922676 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 89 | 810128 | 810316 | + | NZ_CP030280.1 | Blautia argi |
| 90 | 3190382 | 3190585 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 91 | 1369950 | 1370147 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 92 | 857823 | 858011 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 93 | 3168799 | 3168987 | + | NZ_CP023671.1 | Clostridium septicum |
| 94 | 1440403 | 1440591 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 95 | 3767216 | 3767404 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 96 | 297065 | 297256 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 97 | 1649362 | 1649550 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 98 | 2594866 | 2595054 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 99 | 1806920 | 1807117 | + | NZ_CP015581.1 | Tatumella citrea |
| 100 | 3121427 | 3121624 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 101 | 1796864 | 1797052 | + | NZ_CP043998.1 | Clostridium diolis |
| 102 | 2345227 | 2345424 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 103 | 2098968 | 2099153 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 104 | 533241 | 533426 | + | NZ_AP019736.1 | Alistipes dispar |
| 105 | 226229 | 226414 | + | NZ_AP019735.1 | Alistipes communis |
| 106 | 3548266 | 3548466 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 107 | 1387603 | 1387797 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 108 | 1999744 | 1999932 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 109 | 1921318 | 1921506 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 110 | 3308058 | 3308246 | - | NZ_CP028842.1 | Clostridium botulinum |
| 111 | 3551061 | 3551249 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 112 | 1498468 | 1498665 | + | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 113 | 1764824 | 1765021 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 114 | 1967411 | 1967608 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 115 | 2693417 | 2693614 | - | NZ_LR134201.1 | Cedecea lapagei |
| 116 | 2098806 | 2099003 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 117 | 4171566 | 4171763 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 118 | 4792675 | 4792863 | - | NZ_CP039126.1 | Blautia producta |
| 119 | 2618942 | 2619133 | + | NC_022097.1 | Treponema pedis str. T A4 |
| 120 | 1786854 | 1787051 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 121 | 1716111 | 1716308 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 122 | 2088455 | 2088652 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 123 | 1813429 | 1813626 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 124 | 2298830 | 2299027 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 125 | 2293662 | 2293859 | - | NZ_CP038853.1 | Pantoea vagans |
| 126 | 1952834 | 1953031 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 127 | 2132079 | 2132276 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 128 | 775796 | 775993 | - | NZ_CP070062.1 | Coprococcus comes |
| 129 | 90328 | 90525 | + | NC_016893.1 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony) |
| 130 | 457804 | 457992 | - | NZ_LT996885.1 | Dialister massiliensis |
| 131 | 1761848 | 1762045 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 132 | 1282331 | 1282519 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 133 | 70204 | 70395 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 134 | 870474 | 870662 | + | NZ_CP044060.1 | Aeromonas veronii |
| 135 | 1068980 | 1069168 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 136 | 2230736 | 2230933 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 137 | 3823926 | 3824123 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 138 | 2556888 | 2557085 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 139 | 2651297 | 2651494 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 140 | 1040739 | 1040936 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 141 | 1722521 | 1722703 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 142 | 3065807 | 3065995 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 143 | 2871103 | 2871291 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 144 | 3242003 | 3242188 | - | NZ_CP019870.1 | Clostridioides difficile |
| 145 | 2330931 | 2331119 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 146 | 3199059 | 3199229 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 147 | 2129769 | 2129957 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 148 | 1773115 | 1773303 | - | NZ_CP014204.2 | Clostridium baratii |
| 149 | 1095834 | 1096019 | - | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 150 | 4324289 | 4324483 | - | NZ_CP040106.1 | Echinicola rosea |
| 151 | 1620269 | 1620457 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 152 | 1751115 | 1751303 | - | NZ_CP014322.1 | Alteromonas addita |
| 153 | 2393658 | 2393846 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 154 | 1731976 | 1732164 | - | NC_012968.1 | Methylotenera mobilis JLW8 |
| 155 | 1552719 | 1552907 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 156 | 2740031 | 2740216 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 157 | 2439951 | 2440136 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 158 | 893036 | 893224 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 159 | 1413908 | 1414099 | + | NZ_CP072793.1 | Thiothrix unzii |
| 160 | 570973 | 571170 | + | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 161 | 2652468 | 2652653 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 162 | 1439493 | 1439690 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 163 | 1353807 | 1353995 | + | NZ_CP030775.1 | Clostridium butyricum |
| 164 | 1643463 | 1643651 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 165 | 2588725 | 2588910 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 166 | 2570246 | 2570431 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 167 | 3604213 | 3604401 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 168 | 2696532 | 2696717 | - | NC_016901.1 | Shewanella baltica OS678 |
| 169 | 807859 | 808047 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 170 | 2328034 | 2328222 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 171 | 2105292 | 2105477 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 172 | 38477 | 38662 | + | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 173 | 1895967 | 1896152 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 174 | 2343689 | 2343874 | - | NC_009092.1 | Shewanella loihica PV-4 |
| 175 | 449610 | 449807 | + | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 176 | 2545384 | 2545569 | - | NZ_CP046378.1 | Shewanella algae |
| 177 | 1156346 | 1156543 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 178 | 2468582 | 2468779 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 179 | 4633762 | 4633947 | + | NZ_CP036200.1 | Shewanella maritima |
| 180 | 763173 | 763358 | - | NZ_CP041783.1 | Shewanella donghaensis |
| 181 | 2429098 | 2429283 | + | NZ_CP020472.1 | Shewanella japonica |
| 182 | 1976204 | 1976392 | - | NC_014207.1 | Methylotenera versatilis 301 |
| 183 | 2643233 | 2643430 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 184 | 2398917 | 2399102 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 185 | 2009528 | 2009713 | + | NC_007954.1 | Shewanella denitrificans OS217 |
| 186 | 3243936 | 3244130 | + | NZ_CP042430.1 | Baekduia soli |
| 187 | 2246430 | 2246615 | + | NZ_CP041036.1 | Shewanella polaris |
| 188 | 2668623 | 2668808 | + | NZ_CP034015.1 | Shewanella livingstonensis |
| 189 | 3510060 | 3510257 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 190 | 2218471 | 2218656 | - | NZ_CP037951.1 | Parashewanella tropica |
| 191 | 3036751 | 3036936 | - | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 192 | 1194725 | 1194910 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 193 | 2234291 | 2234476 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 194 | 2634467 | 2634652 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 195 | 13960 | 14148 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 196 | 2411716 | 2411901 | - | NZ_CP048649.1 | Aminipila butyrica |
| 197 | 3088270 | 3088464 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 198 | 1994304 | 1994492 | - | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 199 | 859202 | 859390 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 200 | 140228 | 140416 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 201 | 858229 | 858417 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 202 | 3649195 | 3649392 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 203 | 321311 | 321508 | + | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 204 | 1419489 | 1419686 | + | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 205 | 1641151 | 1641348 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 206 | 1197960 | 1198154 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 207 | 74509 | 74694 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 208 | 427748 | 427939 | + | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 209 | 397711 | 397908 | - | NZ_AP014564.1 | Ichthyobacterium seriolicida |
| 210 | 3982954 | 3983142 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 211 | 2703560 | 2703748 | - | NC_015167.1 | Cellulophaga lytica DSM 7489 |
| 212 | 724169 | 724354 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 213 | 2196274 | 2196462 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 214 | 423371 | 423559 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 215 | 1367751 | 1367939 | + | NZ_CP010817.1 | Myroides profundi |
| 216 | 547735 | 547923 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 217 | 20090 | 20278 | + | NZ_CP054494.1 | Flavobacterium columnare |
| 218 | 588744 | 588932 | + | NZ_CP017774.1 | Flavobacterium commune |
| 219 | 29680 | 29868 | + | NZ_CP029255.1 | Flavobacterium crocinum |
| 220 | 2116044 | 2116232 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 221 | 2980048 | 2980245 | - | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 222 | 2413076 | 2413273 | - | NZ_CP009976.1 | Cellulophaga baltica 18 |
| 223 | 1354185 | 1354373 | - | NZ_CP017688.1 | Flavobacterium crassostreae |
| 224 | 2505571 | 2505759 | - | NZ_CP020918.1 | Flavobacterium faecale |
| 225 | 1783866 | 1784054 | - | NZ_CP038810.1 | Flavobacterium sangjuense |
| 226 | 5318690 | 5318878 | - | NZ_CP019288.1 | Kordia antarctica |
| 227 | 118823 | 119011 | - | NZ_CP039934.1 | Myroides fluvii |
| 228 | 2002525 | 2002713 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 229 | 33008 | 33196 | + | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 230 | 3633807 | 3633995 | - | NZ_CP037933.1 | Flavobacterium nackdongense |
| 231 | 4056744 | 4056932 | + | NZ_CP020919.1 | Flavobacterium kingsejongi |
| 232 | 2005083 | 2005271 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 233 | 2344947 | 2345135 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 234 | 1188317 | 1188505 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 235 | 2480305 | 2480493 | - | NZ_AP022188.1 | Aeromonas media |
| 236 | 444310 | 444498 | + | NZ_CP031188.1 | Flavobacterium arcticum |
| 237 | 1945384 | 1945572 | - | NZ_CP041637.1 | Formosa sediminum |
| 238 | 1378719 | 1378907 | - | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 239 | 2832331 | 2832519 | + | NC_018721.1 | Psychroflexus torquis ATCC 700755 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015672.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 236 | 29.0 | same-strand | Ribosomal protein L20 |
| 2 | PF00707.24 | 0.93 | 221 | 55.5 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 3 | PF00587.27 | 0.66 | 156 | 679 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 4 | PF03129.22 | 0.65 | 155 | 670 | same-strand | Anticodon binding domain |
| 5 | PF07973.16 | 0.66 | 156 | 674.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..