Result : Q662D1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000013.1 |
| Organism | Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) (Borreliella bavariensis) |
| Left | 236918 |
| Right | 237175 |
| Strand | - |
| Nucleotide Sequence | TTGAGAAAAAATGCATCTGCATTGAAGCGCTCTCGTCAAAATTTAAAAAGAAAGATTAGAAATGTAAGCGTAGAAAGTGAATTAAAAACAATAGAAAAGCGCTGTATCAATATGATTAAAGCGGGCAGGAAAGACGAAGCTATTGAATTTTTTAAGTTTGTTGCAAAAAAACTAGACACTGCTGCTAGAAAGCGAATAATTCATAAAAATAAGGCCGCTAGAAAAAAATCTCGTTTAAATATTTTGCTATTAAAGTAA |
| Sequence | MRKNASALKRSRQNLKRKIRNVSVESELKTIEKRCINMIKAGRKDEAIEFFKFVAKKLDTAARKRIIHKNKAARKKSRLNILLLK |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 15547252 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q662D1 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 237686 | 237943 | - | NZ_CP028861.1 | Borreliella garinii |
| 2 | 236679 | 236936 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 3 | 238793 | 239059 | - | NZ_CP015796.1 | Borreliella mayonii |
| 4 | 236685 | 236942 | - | NZ_CP044535.1 | Borrelia maritima |
| 5 | 236450 | 236665 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 6 | 236563 | 236778 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 7 | 237169 | 237384 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 8 | 249815 | 250030 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 9 | 243570 | 243797 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 10 | 235737 | 235952 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 11 | 670664 | 670918 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 12 | 963994 | 964260 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 13 | 1192876 | 1193136 | + | NZ_LR134357.1 | Actinomyces israelii |
| 14 | 1019745 | 1020011 | - | NZ_CP014945.1 | Psychrobacter alimentarius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028861.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08367.13 | 0.79 | 11 | 2714 | opposite-strand | Peptidase M16C associated |
| 2 | PF05193.23 | 0.79 | 11 | 2714 | opposite-strand | Peptidase M16 inactive domain |
| 3 | PF01197.20 | 0.79 | 11 | 2440 | same-strand | Ribosomal protein L31 |
| 4 | PF07497.14 | 0.79 | 11 | 838 | same-strand | Rho termination factor, RNA-binding domain |
| 5 | PF00006.27 | 0.79 | 11 | 838 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 6 | PF04519.15 | 0.79 | 11 | 342 | same-strand | Polymer-forming cytoskeletal |
| 7 | PF00216.23 | 0.86 | 12 | 12.0 | same-strand | Bacterial DNA-binding protein |
| 8 | PF06071.15 | 0.79 | 11 | 946 | same-strand | Protein of unknown function (DUF933) |
| 9 | PF01926.25 | 0.86 | 12 | 946.5 | same-strand | 50S ribosome-binding GTPase |
| 10 | PF13414.8 | 0.79 | 11 | 2071 | same-strand | TPR repeat |
| 11 | PF20154.1 | 0.79 | 11 | 4223 | opposite-strand | Apolipoprotein N-acyltransferase N-terminal domain |
| 12 | PF00795.24 | 0.79 | 11 | 4223 | opposite-strand | Carbon-nitrogen hydrolase |
++ More..