Result : Q65Q77
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsB |
| NCBI Accession ID | AE016827.1 |
| Organism | Mannheimia succiniciproducens (strain MBEL55E) |
| Left | 2205135 |
| Right | 2205422 |
| Strand | - |
| Nucleotide Sequence | ATGCGTTTATTTATTTTAATTCTCTCGGCAATTCTCTTACTGTTCCAATATGATTTATGGTTCGGTAAAAACGGTTATTTGGACTACAAAGAAACCGCCGAAGAAATTGCCATGCATAAAGCCGAAAATACAAAACTTTCGCAGCGTAATCAGGTGGTCGCCGCCGAAATCAGAGATTTAAAAGACGGGGTTGAAGCAATTCAGGAACGGGCTCGTTTGCAATATGAATTGGTTAAGCCTAACGAAACTTTTTACCGCATTGCGAAAGAAAATAAAGATAACAGATAA |
| Sequence | MRLFILILSAILLLFQYDLWFGKNGYLDYKETAEEIAMHKAENTKLSQRNQVVAAEIRDLKDGVEAIQERARLQYELVKPNETFYRIAKENKDNR |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00599}. |
| Pubmed ID | 15378067 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q65Q77 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1796015 | 1796302 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 2 | 2205135 | 2205422 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 3 | 418105 | 418383 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 4 | 1393938 | 1394216 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 5 | 936750 | 937028 | - | NZ_LR134167.1 | Avibacterium volantium |
| 6 | 1806993 | 1807271 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 7 | 861805 | 862083 | - | NZ_CP028926.1 | Pasteurella multocida |
| 8 | 1928758 | 1929039 | + | NZ_CP018804.1 | Histophilus somni |
| 9 | 535654 | 535932 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 10 | 804138 | 804416 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 11 | 1030711 | 1030989 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 12 | 893042 | 893320 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 13 | 338217 | 338489 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 14 | 1755349 | 1755627 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 15 | 1761176 | 1761454 | + | NZ_CP061280.1 | Mannheimia bovis |
| 16 | 580369 | 580647 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 17 | 489931 | 490170 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 18 | 587635 | 587913 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 19 | 366282 | 366521 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 20 | 1858998 | 1859279 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 21 | 1255666 | 1255944 | - | NZ_CP046531.1 | Mannheimia ovis |
| 22 | 1407875 | 1408153 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 23 | 930926 | 931204 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 24 | 860094 | 860372 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 25 | 11635 | 11910 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 26 | 1802544 | 1802819 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 27 | 401652 | 401930 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 28 | 993233 | 993514 | + | NC_013456.1 | Vibrio antiquarius |
| 29 | 2836274 | 2836555 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 30 | 567830 | 568111 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 31 | 1556677 | 1556976 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 32 | 1910759 | 1911022 | - | NZ_CP049115.1 | Pantoea stewartii |
| 33 | 1046483 | 1046746 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 34 | 884201 | 884464 | + | NZ_CP038853.1 | Pantoea vagans |
| 35 | 906285 | 906548 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 36 | 1030924 | 1031223 | + | NZ_CP015581.1 | Tatumella citrea |
| 37 | 875348 | 875626 | + | NZ_CP017689.1 | Thalassotalea crassostreae |
| 38 | 3184890 | 3185153 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 39 | 779947 | 780225 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 40 | 527107 | 527373 | + | NZ_AP014635.1 | Vibrio tritonius |
| 41 | 1092646 | 1092945 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015031.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02542.18 | 0.98 | 40 | 710.0 | same-strand | YgbB family |
| 2 | PF01128.21 | 1.0 | 41 | 4 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
++ More..