Result : Q65HJ0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AE017333.1 |
| Organism | Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) |
| Left | 2520674 |
| Right | 2520934 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGAAGAAAACAAAACAAACCGGGATGACCTGACATTTGAAGAGGCGATGAAAGGTTTGGAACAGATCGTATCAAAGCTTGAAGAAGGGGACGTGCCTTTGGAAAAGGCGATCGACTATTTCCAGGAGGGGATGGCTCTTTCGAAAATATGCCACGAAAAACTGCAAAATGTCGAAAAACAGATGGACTTCATTTTGCGGGAAAACGGGGAATTAGCTCCTTTCAGTGTTCGGGAGGAGGAAAAAGGTGACCGGTAA |
| Sequence | MAEENKTNRDDLTFEEAMKGLEQIVSKLEEGDVPLEKAIDYFQEGMALSKICHEKLQNVEKQMDFILRENGELAPFSVREEEKGDR |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 15383718 15461803 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q65HJ0 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 89
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2520821 | 2521081 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 2 | 2674392 | 2674652 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 3 | 2796611 | 2796871 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 3154083 | 3154343 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 5 | 2220909 | 2221169 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 6 | 3065510 | 3065770 | + | NZ_CP043404.1 | Bacillus safensis |
| 7 | 1520532 | 1520786 | + | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 2479171 | 2479425 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2399631 | 2399840 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 10 | 2323911 | 2324120 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 11 | 2400843 | 2401052 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 12 | 2386412 | 2386621 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 13 | 2526669 | 2526878 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 14 | 3730474 | 3730683 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 15 | 2489462 | 2489671 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 16 | 1426639 | 1426890 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3348696 | 3348929 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 1528756 | 1528989 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 19 | 2018054 | 2018287 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 20 | 1871849 | 1872061 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 2478693 | 2478923 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 22 | 2427168 | 2427380 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 23 | 1627734 | 1627946 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 24 | 1509752 | 1509964 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 25 | 3510958 | 3511170 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 26 | 4230484 | 4230717 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 27 | 3694453 | 3694692 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 28 | 856109 | 856321 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 2936441 | 2936677 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 30 | 1960583 | 1960816 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 31 | 2445241 | 2445456 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 32 | 2666528 | 2666767 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 33 | 1774520 | 1774753 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 34 | 2170707 | 2170937 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 35 | 2078662 | 2078892 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 36 | 2001120 | 2001359 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 37 | 632582 | 632815 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 38 | 1709699 | 1709932 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 39 | 1912498 | 1912734 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 40 | 2973013 | 2973243 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 41 | 4523570 | 4523803 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 42 | 3335690 | 3335929 | - | NZ_CP053989.1 | Niallia circulans |
| 43 | 5174757 | 5174987 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 44 | 4159714 | 4159947 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 45 | 2444780 | 2445031 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 46 | 2178702 | 2178938 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 47 | 3480454 | 3480687 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 48 | 3528331 | 3528561 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 49 | 1033945 | 1034160 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 50 | 3256618 | 3256851 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 51 | 2909915 | 2910157 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 52 | 3564458 | 3564691 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 53 | 1903086 | 1903328 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 54 | 2575226 | 2575483 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 55 | 3293146 | 3293379 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 56 | 1156062 | 1156295 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 57 | 693486 | 693713 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 58 | 2756080 | 2756331 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 59 | 218746 | 219003 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 60 | 1448289 | 1448501 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 61 | 3060483 | 3060704 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 62 | 4262525 | 4262746 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 63 | 1414675 | 1414911 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 64 | 986781 | 987002 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 65 | 2376287 | 2376505 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 66 | 4790453 | 4790674 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 67 | 4099664 | 4099885 | - | NZ_CP009288.1 | Paenibacillus durus |
| 68 | 1227067 | 1227294 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 69 | 5499390 | 5499611 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 70 | 16526 | 16750 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 71 | 5568035 | 5568298 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 72 | 2042174 | 2042404 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 73 | 2238494 | 2238718 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 74 | 2213892 | 2214110 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 75 | 1220906 | 1221133 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 76 | 2060731 | 2060946 | - | NZ_CP033433.1 | Cohnella candidum |
| 77 | 4618112 | 4618333 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 78 | 2013809 | 2014021 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 79 | 3061531 | 3061800 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 80 | 2572696 | 2572959 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 81 | 2194305 | 2194535 | - | NZ_CP012024.1 | Bacillus smithii |
| 82 | 4822498 | 4822719 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 83 | 6767237 | 6767458 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 84 | 6915558 | 6915779 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 85 | 5413243 | 5413464 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 86 | 1236995 | 1237207 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 87 | 2806111 | 2806347 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 88 | 1643221 | 1643457 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 89 | 714755 | 714988 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006270.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01316.23 | 0.88 | 78 | 4036.0 | same-strand | Arginine repressor, DNA binding domain |
| 2 | PF02863.20 | 0.88 | 78 | 4036.0 | same-strand | Arginine repressor, C-terminal domain |
| 3 | PF01728.21 | 1.0 | 89 | 2988 | same-strand | FtsJ-like methyltransferase |
| 4 | PF01479.27 | 0.94 | 84 | 2992.0 | same-strand | S4 domain |
| 5 | PF13292.8 | 0.88 | 78 | 1113.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 6 | PF02779.26 | 0.88 | 78 | 1113.0 | same-strand | Transketolase, pyrimidine binding domain |
| 7 | PF02780.22 | 0.87 | 77 | 1113 | same-strand | Transketolase, C-terminal domain |
| 8 | PF00348.19 | 1.0 | 89 | -3 | same-strand | Polyprenyl synthetase |
| 9 | PF02601.17 | 1.0 | 89 | 0 | same-strand | Exonuclease VII, large subunit |
| 10 | PF13742.8 | 0.99 | 88 | 0.0 | same-strand | OB-fold nucleic acid binding domain |
| 11 | PF01336.27 | 0.99 | 88 | 0.0 | same-strand | OB-fold nucleic acid binding domain |
| 12 | PF02882.21 | 0.96 | 85 | 1404 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 13 | PF00763.25 | 0.96 | 85 | 1404 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 14 | PF01029.20 | 0.98 | 87 | 2304 | same-strand | NusB family |
| 15 | PF03780.15 | 0.72 | 64 | 2895.5 | same-strand | Asp23 family, cell envelope-related function |
| 16 | PF02786.19 | 0.67 | 60 | 3329.0 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 17 | PF00289.24 | 0.67 | 60 | 3329.0 | same-strand | Biotin carboxylase, N-terminal domain |
| 18 | PF02785.21 | 0.67 | 60 | 3329.0 | same-strand | Biotin carboxylase C-terminal domain |
| 19 | PF02222.24 | 0.65 | 58 | 3321.0 | same-strand | ATP-grasp domain |
| 20 | PF08443.13 | 0.66 | 59 | 3332 | same-strand | RimK-like ATP-grasp domain |
| 21 | PF02655.16 | 0.62 | 55 | 3326 | same-strand | ATP-grasp domain |
++ More..