ProsmORF-pred
Result : Q64TK1
Protein Information
Information Type Description
Protein name 50S ribosomal protein L28
NCBI Accession ID AP006841.1
Organism Bacteroides fragilis (strain YCH46)
Left 2807286
Right 2807546
Strand -
Nucleotide Sequence ATGTCGAAGATTTGTCAAATTACCGGAAAGAAAGCCATGATTGGCAACAATGTTTCACACTCAAAGAGAAGAACTAAAAGAACCTTTGATTTGAACTTGTTTAACAAAAAGTTCTACTATGTAGAACAGGACTGCTGGATCAGCCTGAGCCTCTGTGCTGCTGGTTTGCGTATTATTAATAAGAAAGGTTTGGACGCTGCTTTGAATGATGCGGTTGCCAAAGGGTATTGTGATTGGAAAACCATTAAAGTTGTTGGCTAA
Sequence MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSLCAAGLRIINKKGLDAALNDAVAKGYCDWKTIKVVG
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Pubmed ID 15466707
Domain CDD:412338
Functional Category Ribosomal_protein
Uniprot ID Q64TK1
ORF Length (Amino Acid) 86
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 166
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2843487 2843747 - NZ_LN877293.1 Bacteroides fragilis
2 4704902 4705162 - NZ_CP040530.1 Bacteroides thetaiotaomicron
3 1993989 1994249 + NZ_CP015401.2 Bacteroides caecimuris
4 914426 914686 + NZ_CP012938.1 Bacteroides ovatus
5 1080023 1080283 - NZ_CP027234.1 Bacteroides heparinolyticus
6 2773428 2773688 + NC_014933.1 Bacteroides helcogenes P 36-108
7 458815 459075 - NZ_CP027231.1 Bacteroides zoogleoformans
8 1391694 1391954 + NZ_CP069440.1 Phocaeicola coprophilus
9 4110842 4111102 + NC_009614.1 Phocaeicola vulgatus ATCC 8482
10 4518946 4519206 + NZ_LR699004.1 Phocaeicola dorei
11 616592 616852 + NC_015164.1 Phocaeicola salanitronis DSM 18170
12 611766 612026 + NZ_LR215980.1 Paraprevotella xylaniphila YIT 11841
13 2013735 2013998 - NZ_LR134384.1 Prevotella oris
14 550048 550311 + NZ_CP013195.1 Prevotella enoeca
15 476419 476682 - NC_014371.1 Prevotella melaninogenica ATCC 25845
16 416591 416854 + NZ_CP023864.1 Prevotella jejuni
17 882195 882458 + NC_014033.1 Prevotella ruminicola 23
18 505846 506109 - NZ_CP012075.1 Prevotella fusca JCM 17724
19 526890 527153 + NZ_CP024728.1 Prevotella intermedia
20 582212 582472 + NZ_CP015402.2 Muribaculum intestinale
21 2976567 2976821 + NZ_CP007034.1 Barnesiella viscericola DSM 18177
22 2107733 2107972 - NC_010729.1 Porphyromonas gingivalis ATCC 33277
23 1422106 1422345 - NC_014734.1 Paludibacter propionicigenes WB4
24 1223607 1223846 + NZ_CP054012.1 Parabacteroides distasonis
25 1146220 1146459 + NZ_LT608328.1 Petrimonas mucosa
26 2116139 2116387 + NC_015501.1 Porphyromonas asaccharolytica DSM 20707
27 1989127 1989384 - NZ_LS483447.1 Porphyromonas crevioricanis
28 4335315 4335557 + NZ_CP007451.1 Draconibacterium orientale
29 993526 993777 + NZ_LR134506.1 Porphyromonas cangingivalis
30 3221984 3222226 - NZ_CP069450.1 Butyricimonas virosa
31 876764 877006 - NZ_CP032819.1 Butyricimonas faecalis
32 870133 870372 + NZ_LT605205.1 Proteiniphilum saccharofermentans
33 1036625 1036867 - NZ_LT906459.1 Odoribacter splanchnicus
34 5077221 5077463 + NZ_AP018042.1 Labilibaculum antarcticum
35 4362410 4362655 - NZ_CP021904.1 Alkalitalea saponilacus
36 1050893 1051129 + NZ_AP014564.1 Ichthyobacterium seriolicida
37 355399 355635 - NZ_CP025938.1 Tamlana carrageenivorans
38 1103923 1104162 - NZ_CP061813.1 Polaribacter haliotis
39 3376971 3377207 - NZ_CP010817.1 Myroides profundi
40 2640858 2641097 + NZ_CP019419.1 Polaribacter reichenbachii
41 3573932 3574171 + NZ_CP040812.1 Antarcticibacterium flavum
42 1531144 1531380 + NZ_CP007202.1 Siansivirga zeaxanthinifaciens CC-SAMT-1
43 426696 426935 + NZ_CP014224.1 Wenyingzhuangia fucanilytica
44 3965698 3965934 + NZ_CP012898.1 Algibacter alginicilyticus
45 3097279 3097515 + NC_015321.1 Fluviicola taffensis DSM 16823
46 2262070 2262309 + NC_018013.1 Aequorivita sublithincola DSM 14238
47 1847365 1847601 + NZ_CP053352.1 Winogradskyella helgolandensis
48 1349257 1349493 - NZ_CP025791.1 Flavivirga eckloniae
49 3703614 3703853 - NZ_LT899436.1 Tenacibaculum jejuense
50 515124 515363 + NZ_CP018155.1 Tenacibaculum todarodis
51 3934868 3935104 - NZ_CP042831.1 Flavobacterium alkalisoli
52 2780370 2780606 - NZ_CP034120.1 Glaciecola amylolytica
53 1499118 1499357 + NZ_CP034930.1 Apibacter raozihei
54 588105 588341 - NZ_CP039934.1 Myroides fluvii
55 3075955 3076194 - NZ_CP015125.1 Dokdonia donghaensis DSW-1
56 2024640 2024876 + NZ_CP041637.1 Formosa sediminum
57 3300151 3300387 + NZ_CP022957.1 Maribacter cobaltidurans
58 1289529 1289768 - NZ_CP018153.1 Gramella salexigens
59 2388483 2388722 - NC_008571.1 Gramella forsetii KT0803
60 4917492 4917728 + NZ_CP019288.1 Kordia antarctica
61 868667 868906 - NZ_CP013355.1 Lutibacter profundi
62 579245 579481 - NZ_CP039456.1 Changchengzhania lutea
63 1160422 1160658 + NZ_CP053348.1 Winogradskyella forsetii
64 2887331 2887570 + NZ_CP016359.1 Gramella flava JLT2011
65 2140796 2141035 - NZ_CP020822.1 Tenacibaculum maritimum
66 1542530 1542766 - NZ_LR134404.1 Weeksella virosa
67 4148706 4148945 - NZ_CP050995.1 Chryseobacterium gallinarum
68 4155653 4155892 - NZ_CP023049.2 Chryseobacterium piperi
69 2462895 2463131 + NZ_CP011071.1 Muricauda lutaonensis
70 2184579 2184815 + NZ_CP061703.1 Mesoflavibacter profundi
71 1642502 1642738 + NZ_CP032050.1 Euzebyella marina
72 1083364 1083600 + NZ_CP053351.1 Winogradskyella schleiferi
73 2356879 2357115 - NZ_CP019352.1 Lacinutrix venerupis
74 3742860 3743099 + NZ_CP017477.1 Polaribacter vadi
75 1352527 1352766 + NC_014041.1 Zunongwangia profunda SM-A87
76 1693610 1693849 - NZ_CP019342.1 Nonlabens tegetincola
77 2613496 2613735 + NZ_CP028136.1 Gramella fulva
78 4804841 4805083 - NZ_CP013118.1 Salinivirga cyanobacteriivorans
79 105811 106050 + NZ_CP017478.1 Urechidicola croceus
80 1176042 1176275 + NZ_LT615228.1 Polynucleobacter necessarius
81 33204 33440 - NZ_CP031188.1 Flavobacterium arcticum
82 3813883 3814125 + NZ_CP033929.1 Chryseobacterium indoltheticum
83 1629234 1629467 + NZ_CP041345.1 Tenuifilum thalassicum
84 449549 449785 - NZ_CP058595.1 Costertonia aggregata
85 3532776 3533015 + NZ_CP033914.1 Chryseobacterium shandongense
86 2509074 2509298 + NZ_CP029463.1 Flavobacterium sediminis
87 1740579 1740818 - NZ_CP014766.1 Pontibacter akesuensis
88 3967841 3968077 - NZ_CP029186.1 Flavobacterium album
89 733042 733278 - NC_015844.1 Zobellia galactanivorans
90 23214 23450 - NZ_CP013210.1 Empedobacter brevis
91 2455023 2455262 + NC_020156.1 Nonlabens dokdonensis DSW-6
92 3077483 3077731 + NZ_CP034161.1 Epilithonimonas vandammei
93 784768 785001 - NZ_CP022389.1 Capnocytophaga canimorsus
94 3393713 3393955 - NZ_LR215974.1 Chryseobacterium taihuense
95 1910508 1910750 + NZ_CP022986.1 Chryseobacterium camelliae
96 2298581 2298823 + NZ_CP033926.1 Chryseobacterium joostei
97 163224 163466 + NZ_CP033932.1 Chryseobacterium bernardetii
98 2377255 2377497 - NZ_CP033920.1 Chryseobacterium carnipullorum
99 4772804 4773046 + NZ_LR134386.1 Chryseobacterium nakagawai
100 2628033 2628275 + NZ_LR134289.1 Chryseobacterium gleum
101 226400 226642 + NZ_CP033924.1 Chryseobacterium lactis
102 140237 140473 + NZ_CP053698.1 Empedobacter stercoris
103 2192778 2193014 + NZ_CP020918.1 Flavobacterium faecale
104 3074438 3074677 - NZ_CP048106.1 Pontibacter pudoricolor
105 2464746 2464982 + NC_016001.1 Flavobacterium branchiophilum FL-15
106 653060 653302 - NC_019904.1 Echinicola vietnamensis DSM 17526
107 2405426 2405668 - NZ_CP030041.1 Echinicola strongylocentroti
108 566004 566246 - NZ_CP040106.1 Echinicola rosea
109 1296129 1296362 + NZ_CP030086.1 Polynucleobacter paneuropaeus
110 3406031 3406267 + NZ_CP015067.2 Elizabethkingia anophelis
111 3261069 3261305 - NZ_CP014337.1 Elizabethkingia bruuniana
112 2805344 2805571 + NZ_CP030104.1 Flagellimonas maritima
113 3109434 3109676 + NZ_CP012040.1 Cyclobacterium amurskyense
114 3099509 3099751 + NC_015914.1 Cyclobacterium marinum DSM 745
115 3821899 3822135 - NZ_CP020919.1 Flavobacterium kingsejongi
116 525056 525292 - NC_015167.1 Cellulophaga lytica DSM 7489
117 1487217 1487453 + NC_017045.1 Riemerella anatipestifer ATCC 11845 = DSM 15868
118 662392 662628 - NZ_CP006828.1 Ornithobacterium rhinotracheale ORT-UMN 88
119 1892316 1892552 + NZ_CP038810.1 Flavobacterium sangjuense
120 2418941 2419168 + NC_015945.1 Muricauda ruestringensis DSM 13258
121 2949531 2949773 - NZ_CP015199.1 Chryseobacterium glaciei
122 235631 235867 - NZ_CP054494.1 Flavobacterium columnare
123 1603617 1603853 - NZ_LR134503.1 Kaistella jeonii
124 1399210 1399449 + NZ_CP034549.1 Nonlabens ponticola
125 853258 853497 - NZ_CP055156.1 Adhaeribacter swui
126 883483 883722 + NZ_CP055153.1 Adhaeribacter radiodurans
127 1539489 1539725 - NZ_CP037933.1 Flavobacterium nackdongense
128 2768646 2768882 + NC_014934.1 Cellulophaga algicola DSM 14237
129 1685847 1686089 - NZ_CP034159.1 Kaistella carnis
130 1683028 1683261 + NZ_CP007501.1 Polynucleobacter duraquae
131 1805766 1805999 + NC_009379.1 Polynucleobacter asymbioticus QLW-P1DMWA-1
132 940174 940419 + NZ_CP063145.1 Cruoricaptor ignavus
133 332878 333111 + NZ_AP023049.1 Alistipes indistinctus
134 5417916 5418152 + NZ_CP048832.1 Janthinobacterium lividum
135 1225088 1225324 - NZ_CP042434.1 Arachidicoccus ginsenosidivorans
136 497936 498172 + NZ_CP040908.1 Empedobacter falsenii
137 3215959 3216195 - NC_013222.1 Robiginitalea biformata HTCC2501
138 2808510 2808749 + NC_018721.1 Psychroflexus torquis ATCC 700755
139 1645173 1645406 + NZ_CP023276.1 Polynucleobacter difficilis
140 969954 970187 - NZ_AP019735.1 Alistipes communis
141 952306 952539 - NZ_CP041352.1 Casimicrobium huifangae
142 2206095 2206331 + NZ_CP009976.1 Cellulophaga baltica 18
143 307391 307627 - NC_007947.1 Methylobacillus flagellatus KT
144 339988 340224 - NC_012969.1 Methylovorus glucosetrophus SIP3-4
145 2054325 2054561 - NZ_LT906465.1 Chryseobacterium taklimakanense
146 5332852 5333088 + NZ_CP028324.1 Massilia armeniaca
147 2853003 2853245 + NZ_LR134441.1 Kaistella antarctica
148 938336 938569 + NZ_AP019736.1 Alistipes dispar
149 2274326 2274559 - NC_018011.1 Alistipes finegoldii DSM 17242
150 1736354 1736587 - NZ_LR590484.1 Sphingobacterium thalpophilum
151 3530371 3530607 + NZ_CP040017.1 Massilia umbonata
152 4320922 4321155 + NZ_CP060723.1 Pedobacter roseus
153 3191487 3191726 - NZ_CP029480.1 Arcticibacterium luteifluviistationis
154 1093282 1093518 - NZ_AP012273.1 Thiolapillus brandeum
155 5358186 5358422 + NZ_CP023422.1 Janthinobacterium svalbardensis
156 3007513 3007749 + NZ_CP041185.1 Janthinobacterium tructae
157 2405984 2406220 + NZ_CP046904.1 Massilia flava
158 952751 952987 - NZ_CP036401.1 Massilia albidiflava
159 512310 512546 + NZ_CP032489.1 Arachidicoccus soli
160 1267428 1267664 - NZ_HG322949.1 Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
161 754615 754851 + NC_022357.1 Sulfuricella denitrificans skB26
162 4191813 4192046 + NC_013061.1 Pedobacter heparinus DSM 2366
163 1990745 1990981 - NZ_CP048113.1 Chitinophaga agri
164 3804556 3804792 + NC_013132.1 Chitinophaga pinensis DSM 2588
165 204845 205081 + NZ_CP045871.1 Litoricola lipolytica
166 1701135 1701368 - NZ_LR027382.1 Alistipes megaguti
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LN877293.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00448.24 0.75 125 546 same-strand SRP54-type protein, GTPase domain
2 PF02881.21 0.75 125 546 same-strand SRP54-type protein, helical bundle domain
3 PF14128.8 0.87 144 219.5 same-strand Domain of unknown function (DUF4295)
4 PF00471.22 0.98 163 21 same-strand Ribosomal protein L33
++ More..