Result : Q64NL6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AP006841.1 |
| Organism | Bacteroides fragilis (strain YCH46) |
| Left | 4770841 |
| Right | 4771038 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTGCAGAAATTAAAGAAATGTCTACTAATGATTTGGTAGAAAGAGTAGAAGCAGAAGTGGTTAATTACAACCAAATGGTTATCAATCATTCTATTTCTCCTTTGGAAAATCCTGCGCAGATCAAACAATTACGCAGGACGATTGCGCGTATGAGAACAGAGTTACGCCAAAGAGAACTTAACAATAAATGA |
| Sequence | MKIAEIKEMSTNDLVERVEAEVVNYNQMVINHSISPLENPAQIKQLRRTIARMRTELRQRELNNK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 15466707 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q64NL6 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4683373 | 4683570 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 2 | 1531916 | 1532113 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 3 | 676590 | 676787 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 4 | 3407330 | 3407527 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 5 | 1384126 | 1384323 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 6 | 3844591 | 3844788 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 7 | 1360693 | 1360890 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 8 | 2317096 | 2317293 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 9 | 1096852 | 1097046 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 10 | 1101314 | 1101508 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 11 | 3260848 | 3261042 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 12 | 3220880 | 3221077 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 13 | 2179935 | 2180129 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 14 | 2531788 | 2531982 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 15 | 2079455 | 2079649 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 16 | 1991620 | 1991817 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 17 | 388684 | 388881 | - | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 18 | 3094634 | 3094831 | + | NZ_CP015402.2 | Muribaculum intestinale |
| 19 | 71755 | 71949 | - | NZ_CP024727.1 | Prevotella intermedia |
| 20 | 446638 | 446832 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 21 | 436812 | 437006 | + | NZ_CP023863.1 | Prevotella jejuni |
| 22 | 2778400 | 2778600 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 23 | 2830924 | 2831118 | - | NZ_LR134384.1 | Prevotella oris |
| 24 | 1148162 | 1148356 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 25 | 263567 | 263761 | + | NZ_CP013195.1 | Prevotella enoeca |
| 26 | 1015949 | 1016152 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 27 | 2982451 | 2982645 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 28 | 1543479 | 1543676 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 29 | 3048089 | 3048292 | + | NZ_CP007451.1 | Draconibacterium orientale |
| 30 | 3814479 | 3814670 | - | NZ_LT899436.1 | Tenacibaculum jejuense |
| 31 | 339275 | 339466 | - | NZ_CP019419.1 | Polaribacter reichenbachii |
| 32 | 3583655 | 3583846 | + | NZ_CP017477.1 | Polaribacter vadi |
| 33 | 2744981 | 2745181 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 34 | 3496234 | 3496428 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 35 | 128626 | 128820 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 36 | 1786058 | 1786249 | + | NZ_AP019736.1 | Alistipes dispar |
| 37 | 863776 | 863973 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 38 | 1732716 | 1732907 | - | NZ_CP061813.1 | Polaribacter haliotis |
| 39 | 2180838 | 2181029 | - | NZ_CP020822.1 | Tenacibaculum maritimum |
| 40 | 2937697 | 2937897 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 41 | 520019 | 520225 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 42 | 1258172 | 1258366 | - | NZ_AP019735.1 | Alistipes communis |
| 43 | 1926812 | 1927000 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 44 | 276559 | 276753 | + | NZ_CP010777.1 | Rufibacter radiotolerans |
| 45 | 3767207 | 3767407 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 46 | 430123 | 430317 | - | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 47 | 1396403 | 1396594 | + | NZ_LR027382.1 | Alistipes megaguti |
| 48 | 2853859 | 2854017 | - | NZ_LT608328.1 | Petrimonas mucosa |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN877293.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.98 | 47 | 1539 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 1.0 | 48 | 975.5 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 1.0 | 48 | 975.5 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 0.98 | 47 | 658 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 0.98 | 47 | 658 | same-strand | KOW motif |
| 6 | PF00238.21 | 0.98 | 47 | 272 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 0.98 | 47 | 12 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 48 | 7.0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 48 | 463.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 48 | 463.0 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 48 | 1201.0 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 1.0 | 48 | 1648.0 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 1.0 | 48 | 1938.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 1.0 | 48 | 1938.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..