Result : Q637L7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein Tlp |
| NCBI Accession ID | CP000001.1 |
| Organism | Bacillus cereus (strain ZK / E33L) |
| Left | 3448301 |
| Right | 3448498 |
| Strand | - |
| Nucleotide Sequence | ATGCCAAATCCAGATAATCGAAGTGATAACGCTGAAAAGTTACAAGAAATGGTGCAAAATACAATTGATAACTTTAATGAAGCAAAAGAAACAGCGGAGCTTTCTAATGAAAAAGATCGTTCTGCTATTGAAGCAAAAAATCAAAGACGTTTAGAAAGTATTGACTCATTAAAAAGTGAAATCAAAGATGAATCTTAA |
| Sequence | MPNPDNRSDNAEKLQEMVQNTIDNFNEAKETAELSNEKDRSAIEAKNQRRLESIDSLKSEIKDES |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 16621833 |
| Domain | CDD:186720 |
| Functional Category | Others |
| Uniprot ID | Q637L7 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3375506 | 3375703 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 3636860 | 3637057 | - | NC_011725.1 | Bacillus cereus B4264 |
| 3 | 2352460 | 2352672 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 4 | 3058633 | 3058806 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 5 | 2065423 | 2065650 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 6 | 2185501 | 2185737 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 7 | 1498401 | 1498634 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 8 | 2378098 | 2378331 | - | NZ_LS483476.1 | Lederbergia lentus |
| 9 | 1779135 | 1779365 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 10 | 2871177 | 2871410 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 11 | 1894399 | 1894584 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 12 | 847830 | 848054 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 13 | 777401 | 777583 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 14 | 1599808 | 1599999 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 15 | 2341150 | 2341341 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 16 | 1078429 | 1078620 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 17 | 1967725 | 1967907 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 18 | 1838829 | 1839014 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 19 | 1930513 | 1930698 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 20 | 1892593 | 1892778 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 21 | 1782689 | 1782871 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 22 | 3721822 | 3722046 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 23 | 1696028 | 1696261 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 24 | 1962134 | 1962316 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 25 | 1751423 | 1751638 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 26 | 1870994 | 1871218 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 27 | 1940534 | 1940749 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 28 | 3752187 | 3752414 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 29 | 2022587 | 2022796 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 30 | 3647711 | 3647938 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 31 | 1883207 | 1883428 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 32 | 2040401 | 2040595 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 33 | 2572216 | 2572440 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 34 | 1444835 | 1445059 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 35 | 3946081 | 3946314 | - | NZ_CP053989.1 | Niallia circulans |
| 36 | 1963920 | 1964135 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 37 | 1989775 | 1990011 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 38 | 1795035 | 1795259 | + | NZ_CP033433.1 | Cohnella candidum |
| 39 | 2793870 | 2794088 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 40 | 2341510 | 2341737 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 41 | 762398 | 762634 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 42 | 781909 | 782127 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 43 | 152782 | 152994 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007530.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03061.24 | 0.77 | 33 | 153.5 | same-strand | Thioesterase superfamily |
| 2 | PF13279.8 | 0.77 | 33 | 118 | same-strand | Thioesterase-like superfamily |
| 3 | PF08177.13 | 0.6 | 26 | 88.5 | same-strand | Small acid-soluble spore protein N family |
| 4 | PF13040.8 | 0.65 | 28 | 278.0 | same-strand | Fur-regulated basic protein B |
| 5 | PF00578.23 | 0.67 | 29 | 520 | same-strand | AhpC/TSA family |
| 6 | PF08534.12 | 0.67 | 29 | 520 | same-strand | Redoxin |
| 7 | PF13905.8 | 0.65 | 28 | 519.5 | same-strand | Thioredoxin-like |
| 8 | PF13098.8 | 0.63 | 27 | 520 | same-strand | Thioredoxin-like domain |
++ More..