Protein Information |
Information Type | Description |
---|---|
Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
NCBI Accession ID | AE017282.2 |
Organism | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
Left | 1539947 |
Right | 1540228 |
Strand | + |
Nucleotide Sequence | ATGAGTCTGCAACCCGATACCCTGTTGGAACTGTCGCCTCTGCTGCGTATGCAATGGGAAGAAGCTCAGCAGCGCTACGTCATACTTTATCCCGAAGGCATGATCGAATTGAACGAAACCGCCGCGGCGATCCTGGAACTTTGTGACGGCCAGCACAATCTCACCAGCATCGTGGACAAGCTGGAACGGAAATACGATGCCTCGGGAATCGAACCCGATGTGCGCGAAATGCTCGAAAGCGCCCTGAACAATGGCTGGATCAGAGAAATCATCGCTTACTAA |
Sequence | MSLQPDTLLELSPLLRMQWEEAQQRYVILYPEGMIELNETAAAILELCDGQHNLTSIVDKLERKYDASGIEPDVREMLESALNNGWIREIIAY |
Source of smORF | Swiss-Prot |
Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00655}. |
Pubmed ID | 15383840 |
Domain | CDD:414309 |
Functional Category | Others |
Uniprot ID | Q608P1 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1539947 | 1540228 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
2 | 1089622 | 1089894 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
3 | 2799799 | 2800071 | - | NZ_CP014476.1 | Methylomonas denitrificans |
4 | 2473129 | 2473410 | + | NZ_AP017928.1 | Methylocaldum marinum |
5 | 662033 | 662305 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
6 | 631959 | 632231 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
7 | 770432 | 770704 | - | NC_015572.1 | Methylomonas methanica MC09 |
8 | 3991098 | 3991361 | + | NZ_CP036401.1 | Massilia albidiflava |
9 | 488524 | 488787 | - | NZ_CP040017.1 | Massilia umbonata |
10 | 2977948 | 2978217 | + | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
11 | 1014707 | 1014970 | + | NZ_CP046904.1 | Massilia flava |
12 | 3663487 | 3663753 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
13 | 402220 | 402501 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
14 | 3357285 | 3357521 | + | NZ_CP019038.1 | Massilia putida |
15 | 1762992 | 1763267 | - | NZ_CP012373.2 | Beggiatoa leptomitoformis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12706.9 | 0.93 | 14 | 744.5 | same-strand | Beta-lactamase superfamily domain |
2 | PF03070.18 | 1.0 | 15 | 25 | same-strand | TENA/THI-4/PQQC family |
3 | PF04055.23 | 1.0 | 15 | -22.0 | same-strand | Radical SAM superfamily |
4 | PF13186.8 | 1.0 | 15 | -22 | same-strand | Iron-sulfur cluster-binding domain |