Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AE017282.2 |
Organism | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
Left | 2170789 |
Right | 2171070 |
Strand | + |
Nucleotide Sequence | ATGGCTCGCATCACCGTCGAAGATTGCCTGGACAAAGTCGAAAACCGTTTTCAGCTCGTGCTGCTCGCCAGCAAGCGGGCCCGTGTGCTGGCACGCCATCCCGAAGAAGCCAAGGTGACCTGGGACAACGACAAGCCGACCGTGGTAGCCTTGCGCGAAATCGCCGAAGGGCACATTACACCTGCCTACATGAAGGAGAAGGTGAAGACGGACCGTTATCCAATCGAACGCCCGATGCCGGCACCCCGCGACGATCTCGCCGACCTTGACGACGACATCTAG |
Sequence | MARITVEDCLDKVENRFQLVLLASKRARVLARHPEEAKVTWDNDKPTVVALREIAEGHITPAYMKEKVKTDRYPIERPMPAPRDDLADLDDDI |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | 15383840 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | Q606J4 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2170789 | 2171070 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
2 | 5362806 | 5363099 | - | NZ_AP017928.1 | Methylocaldum marinum |
3 | 3540964 | 3541230 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
4 | 2223669 | 2223953 | - | NZ_AP012273.1 | Thiolapillus brandeum |
5 | 3603715 | 3603966 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
6 | 3985242 | 3985520 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
7 | 3301649 | 3301918 | + | NZ_CP029822.1 | Entomomonas moraniae |
8 | 1706269 | 1706523 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
9 | 2408373 | 2408633 | + | NZ_CP014226.1 | Halomonas chromatireducens |
10 | 1031299 | 1031556 | + | NZ_CP059082.1 | Halomonas titanicae |
11 | 4002721 | 4003002 | + | NZ_CP016268.1 | Woeseia oceani |
12 | 3633891 | 3634166 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
13 | 104517 | 104780 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
14 | 3835745 | 3836020 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
15 | 4362345 | 4362605 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
16 | 196530 | 196820 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
17 | 948786 | 949052 | + | NZ_CP014143.1 | Microbulbifer aggregans |
18 | 4687148 | 4687405 | + | NZ_CP013106.1 | Halomonas huangheensis |
19 | 4257705 | 4257977 | - | NZ_CP031769.1 | Salinimonas sediminis |
20 | 3980006 | 3980266 | + | NZ_CP021435.1 | Halomonas beimenensis |
21 | 4681213 | 4681485 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
22 | 4160579 | 4160842 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
23 | 190550 | 190822 | + | NZ_CP036536.1 | Salinimonas lutimaris |
24 | 3339275 | 3339538 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
25 | 2431626 | 2431874 | + | NZ_CP025120.1 | Kangiella profundi |
26 | 2311455 | 2311727 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
27 | 642146 | 642436 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13328.8 | 1.0 | 27 | 46 | same-strand | HD domain |
2 | PF04607.19 | 1.0 | 27 | 46 | same-strand | Region found in RelA / SpoT proteins |
3 | PF02824.23 | 1.0 | 27 | 46 | same-strand | TGS domain |
4 | PF13291.8 | 1.0 | 27 | 46 | same-strand | ACT domain |
5 | PF01966.24 | 1.0 | 27 | 46 | same-strand | HD domain |
6 | PF01042.23 | 0.93 | 25 | 2267 | same-strand | Endoribonuclease L-PSP |
7 | PF00625.23 | 0.81 | 22 | 102.0 | same-strand | Guanylate kinase |