Result : Q606J4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AE017282.2 |
| Organism | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
| Left | 2170789 |
| Right | 2171070 |
| Strand | + |
| Nucleotide Sequence | ATGGCTCGCATCACCGTCGAAGATTGCCTGGACAAAGTCGAAAACCGTTTTCAGCTCGTGCTGCTCGCCAGCAAGCGGGCCCGTGTGCTGGCACGCCATCCCGAAGAAGCCAAGGTGACCTGGGACAACGACAAGCCGACCGTGGTAGCCTTGCGCGAAATCGCCGAAGGGCACATTACACCTGCCTACATGAAGGAGAAGGTGAAGACGGACCGTTATCCAATCGAACGCCCGATGCCGGCACCCCGCGACGATCTCGCCGACCTTGACGACGACATCTAG |
| Sequence | MARITVEDCLDKVENRFQLVLLASKRARVLARHPEEAKVTWDNDKPTVVALREIAEGHITPAYMKEKVKTDRYPIERPMPAPRDDLADLDDDI |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 15383840 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q606J4 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2170789 | 2171070 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 2 | 5362806 | 5363099 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 3 | 3540964 | 3541230 | + | NZ_CP043420.1 | Kushneria phosphatilytica |
| 4 | 2223669 | 2223953 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 5 | 3603715 | 3603966 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 6 | 3985242 | 3985520 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 7 | 3301649 | 3301918 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 8 | 1706269 | 1706523 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 9 | 2408373 | 2408633 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 10 | 1031299 | 1031556 | + | NZ_CP059082.1 | Halomonas titanicae |
| 11 | 4002721 | 4003002 | + | NZ_CP016268.1 | Woeseia oceani |
| 12 | 3633891 | 3634166 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 13 | 104517 | 104780 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 14 | 3835745 | 3836020 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 15 | 4362345 | 4362605 | + | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 16 | 196530 | 196820 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 17 | 948786 | 949052 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 18 | 4687148 | 4687405 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 19 | 4257705 | 4257977 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 20 | 3980006 | 3980266 | + | NZ_CP021435.1 | Halomonas beimenensis |
| 21 | 4681213 | 4681485 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 22 | 4160579 | 4160842 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 23 | 190550 | 190822 | + | NZ_CP036536.1 | Salinimonas lutimaris |
| 24 | 3339275 | 3339538 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 25 | 2431626 | 2431874 | + | NZ_CP025120.1 | Kangiella profundi |
| 26 | 2311455 | 2311727 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 27 | 642146 | 642436 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043420.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13328.8 | 1.0 | 27 | 46 | same-strand | HD domain |
| 2 | PF04607.19 | 1.0 | 27 | 46 | same-strand | Region found in RelA / SpoT proteins |
| 3 | PF02824.23 | 1.0 | 27 | 46 | same-strand | TGS domain |
| 4 | PF13291.8 | 1.0 | 27 | 46 | same-strand | ACT domain |
| 5 | PF01966.24 | 1.0 | 27 | 46 | same-strand | HD domain |
| 6 | PF01042.23 | 0.93 | 25 | 2267 | same-strand | Endoribonuclease L-PSP |
| 7 | PF00625.23 | 0.81 | 22 | 102.0 | same-strand | Guanylate kinase |
++ More..