Result : Q606C8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AE017282.2 |
| Organism | Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) |
| Left | 2248861 |
| Right | 2249082 |
| Strand | - |
| Nucleotide Sequence | TTGTCGATGTCGCACATTTACACCGTCGTGCGTTGTCCCCGCTGCGGCAAGCCGGTACCCTGGAACGAAACGCAGAGATTCAGGCCATTTTGCAGCGAACGTTGTCGGCTGATCGATCTGGGCAGTTGGGCCAACGAGGACTACGCCATTCCCGGTGAACCGATCGATCCGGCGGAGCCGTCCGAGGACCGGAACGGCGCGGAAGGACCCCCTACCGATTGA |
| Sequence | MSMSHIYTVVRCPRCGKPVPWNETQRFRPFCSERCRLIDLGSWANEDYAIPGEPIDPAEPSEDRNGAEGPPTD |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 15383840 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q606C8 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 67
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2248861 | 2249082 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 2 | 1651721 | 1651900 | - | NZ_CP028324.1 | Massilia armeniaca |
| 3 | 5703299 | 5703478 | + | NZ_CP036401.1 | Massilia albidiflava |
| 4 | 5136526 | 5136708 | - | NZ_CP019038.1 | Massilia putida |
| 5 | 293167 | 293346 | + | NZ_CP018787.1 | Oxalobacter formigenes |
| 6 | 1278570 | 1278761 | - | NC_007651.1 | Burkholderia thailandensis E264 |
| 7 | 1166933 | 1167130 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 8 | 3180231 | 3180416 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 9 | 804111 | 804299 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 10 | 4193028 | 4193216 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 11 | 706927 | 707121 | - | NZ_CP013481.2 | Pandoraea apista |
| 12 | 1424697 | 1424891 | - | NZ_CP047385.1 | Pandoraea fibrosis |
| 13 | 5074190 | 5074372 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 14 | 4344286 | 4344465 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 15 | 419732 | 419923 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 16 | 377912 | 378097 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 17 | 4298750 | 4298938 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 18 | 4241155 | 4241370 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 19 | 2501706 | 2501897 | + | NC_021287.1 | Caballeronia insecticola |
| 20 | 771890 | 772081 | - | NZ_LR134494.1 | Serratia quinivorans |
| 21 | 971080 | 971280 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 22 | 439009 | 439209 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 23 | 4087281 | 4087472 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 24 | 3000768 | 3000962 | + | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 25 | 442313 | 442522 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 26 | 3076903 | 3077100 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 27 | 2585883 | 2586077 | - | NZ_CP015958.1 | Paraburkholderia caribensis |
| 28 | 4599187 | 4599396 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 29 | 2717383 | 2717577 | + | NZ_CP046909.1 | Paraburkholderia acidiphila |
| 30 | 4121920 | 4122111 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 31 | 2786189 | 2786374 | + | NZ_CP049134.1 | Paraburkholderia tropica |
| 32 | 859363 | 859554 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 33 | 314401 | 314601 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 34 | 2130253 | 2130444 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 35 | 357691 | 357885 | + | NZ_CP053069.1 | Usitatibacter rugosus |
| 36 | 463806 | 464000 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 37 | 428856 | 429041 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 38 | 2997478 | 2997678 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 39 | 875006 | 875200 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 40 | 2955121 | 2955315 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 41 | 2400207 | 2400401 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 42 | 4971441 | 4971629 | + | NC_008027.1 | Pseudomonas entomophila L48 |
| 43 | 3957287 | 3957481 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 44 | 3229011 | 3229202 | + | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 45 | 5161047 | 5161241 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 46 | 5242622 | 5242810 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 47 | 607860 | 608048 | - | NZ_CP020737.1 | Paraburkholderia acidophila |
| 48 | 1901562 | 1901747 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 49 | 803867 | 804070 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 50 | 3111961 | 3112161 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 51 | 3948676 | 3948888 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 52 | 2736678 | 2736869 | + | NZ_CP046913.1 | Paraburkholderia acidisoli |
| 53 | 2233316 | 2233519 | - | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 54 | 3740851 | 3741048 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 55 | 4027392 | 4027580 | + | NZ_CP009365.1 | Pseudomonas soli |
| 56 | 5015064 | 5015261 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 57 | 3115364 | 3115552 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 58 | 3374807 | 3375010 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 59 | 3241006 | 3241206 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 60 | 3938414 | 3938614 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 61 | 2062415 | 2062612 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 62 | 110228 | 110422 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 63 | 1756529 | 1756723 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 64 | 903097 | 903291 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 65 | 1015894 | 1016091 | - | NZ_LR134531.1 | Pragia fontium |
| 66 | 3852475 | 3852681 | + | NZ_CP046293.1 | Yersinia intermedia |
| 67 | 2263721 | 2263915 | + | NZ_AP019700.1 | Stella humosa |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007651.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00293.30 | 0.64 | 43 | 53 | opposite-strand | NUDIX domain |
| 2 | PF07072.13 | 0.82 | 55 | 25 | same-strand | Cell division protein |
| 3 | PF01121.22 | 0.91 | 61 | 814 | same-strand | Dephospho-CoA kinase |
| 4 | PF01478.20 | 0.64 | 43 | 1481 | same-strand | Type IV leader peptidase family |
| 5 | PF00482.25 | 0.84 | 56 | 2567.5 | same-strand | Type II secretion system (T2SS), protein F |
| 6 | PF00437.22 | 0.67 | 45 | 3786.0 | same-strand | Type II/IV secretion system protein |
| 7 | PF07517.16 | 0.63 | 42 | 1956.5 | opposite-strand | SecA DEAD-like domain |
| 8 | PF07516.15 | 0.63 | 42 | 1956.5 | opposite-strand | SecA Wing and Scaffold domain |
| 9 | PF01043.22 | 0.63 | 42 | 1956.5 | opposite-strand | SecA preprotein cross-linking domain |
| 10 | PF02810.17 | 0.63 | 42 | 1956.5 | opposite-strand | SEC-C motif |
| 11 | PF14815.8 | 0.61 | 41 | 48 | opposite-strand | NUDIX domain |
++ More..