Result : Q601J2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translation initiation factor IF-1 |
| NCBI Accession ID | AE017332.1 |
| Organism | Mycoplasma hyopneumoniae (strain 232) |
| Left | 241453 |
| Right | 241680 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAATTTACCAAAAGAACAAAAACTATTATTTCAGGGAAAAGTCACCCACGTTTTTAATGCCCAGGAATATGAGGTAACTCTCGAAAATGGGATTAAATTAAACTGTCATATCGCGGGAAAAATGAAAATTCATCATATAAAAATTATTATCGGTGATATGGTAAAGGTGGAAATTTCGCCTTATGACTTATCAAAAGGAAGAATAGTTTACCGGTTTAAATAA |
| Sequence | MANLPKEQKLLFQGKVTHVFNAQEYEVTLENGIKLNCHIAGKMKIHHIKIIIGDMVKVEISPYDLSKGRIVYRFK |
| Source of smORF | Swiss-Prot |
| Function | One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. {ECO:0000255|HAMAP-Rule:MF_00075}. |
| Pubmed ID | 15489423 |
| Domain | CDD:415806 |
| Functional Category | RNA-binding |
| Uniprot ID | Q601J2 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 122
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 153486 | 153713 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 2 | 396092 | 396319 | + | NZ_CP024161.1 | Mycoplasma dispar |
| 3 | 554233 | 554460 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 4 | 416518 | 416739 | - | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 5 | 470080 | 470274 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 6 | 24012 | 24206 | + | NZ_LR214938.2 | Mycoplasma salivarium |
| 7 | 758005 | 758247 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 8 | 869821 | 870018 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 9 | 2541578 | 2541805 | + | NZ_CP020121.1 | Comamonas kerstersii |
| 10 | 1807825 | 1808043 | - | NZ_CP026328.2 | Acidithiobacillus caldus |
| 11 | 1768839 | 1769042 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 12 | 434411 | 434614 | + | NZ_CP014164.1 | Aerococcus viridans |
| 13 | 1049137 | 1049355 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 14 | 303412 | 303630 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 15 | 1643221 | 1643436 | - | NZ_CP036425.1 | Poriferisphaera corsica |
| 16 | 2674199 | 2674417 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 17 | 394644 | 394862 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 18 | 883084 | 883302 | + | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 19 | 1515619 | 1515822 | - | NZ_CP014161.1 | Aerococcus urinae |
| 20 | 359433 | 359627 | - | NZ_CP055143.1 | Mycoplasma hominis |
| 21 | 2396714 | 2396938 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 22 | 687384 | 687578 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 23 | 970945 | 971148 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 24 | 1216432 | 1216650 | + | NZ_CP061799.1 | Desulfonema limicola |
| 25 | 370698 | 370892 | - | NZ_LR215047.1 | Mycoplasma arthritidis |
| 26 | 2226455 | 2226673 | + | NZ_LT828648.1 | Nitrospira japonica |
| 27 | 5354125 | 5354358 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 28 | 1310679 | 1310882 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 29 | 2923457 | 2923678 | + | NZ_CP049916.1 | Acinetobacter lanii |
| 30 | 532127 | 532348 | - | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 31 | 4579292 | 4579537 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 32 | 313068 | 313283 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 33 | 1557259 | 1557477 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 34 | 1551478 | 1551717 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 35 | 311620 | 311835 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 36 | 537261 | 537479 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 37 | 1503499 | 1503702 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 38 | 466295 | 466516 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 39 | 1392027 | 1392230 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 40 | 3398 | 3643 | - | NZ_CP027669.1 | Simplicispira suum |
| 41 | 409466 | 409681 | - | NZ_AP018940.1 | Mycoplasmopsis californica |
| 42 | 139875 | 140069 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 43 | 727452 | 727637 | + | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 44 | 659901 | 660086 | + | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 45 | 2820445 | 2820660 | - | NC_017080.1 | Phycisphaera mikurensis NBRC 102666 |
| 46 | 965996 | 966217 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 47 | 403601 | 403822 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 48 | 1252010 | 1252231 | - | NZ_CP012808.1 | Acinetobacter equi |
| 49 | 2689434 | 2689655 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 50 | 2831683 | 2831904 | + | NZ_CP024632.1 | Acinetobacter junii |
| 51 | 2984281 | 2984502 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 52 | 3023857 | 3024078 | + | NZ_CP035934.2 | Acinetobacter cumulans |
| 53 | 2999428 | 2999649 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 54 | 500960 | 501181 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 55 | 403451 | 403672 | - | NZ_CP016895.1 | Acinetobacter larvae |
| 56 | 1580888 | 1581109 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 57 | 3581267 | 3581488 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 58 | 1472718 | 1472939 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 59 | 3503599 | 3503820 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 60 | 3487690 | 3487911 | + | NZ_CP015121.1 | Acinetobacter baumannii |
| 61 | 2603528 | 2603749 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 62 | 3600513 | 3600734 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 63 | 3688362 | 3688583 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 64 | 681390 | 681608 | + | NZ_CP037922.1 | Hymenobacter radiodurans |
| 65 | 1853040 | 1853222 | - | NZ_CP016268.1 | Woeseia oceani |
| 66 | 479241 | 479462 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 67 | 493640 | 493834 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 68 | 1845915 | 1846133 | - | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 69 | 4039036 | 4039254 | - | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 70 | 310748 | 310942 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 71 | 1766045 | 1766263 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 72 | 2385981 | 2386199 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 73 | 2223743 | 2223961 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 74 | 787799 | 788014 | - | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 75 | 1340394 | 1340612 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 76 | 1262790 | 1263008 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 77 | 5325915 | 5326166 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 78 | 2989947 | 2990204 | - | NZ_CP016210.1 | Azoarcus olearius |
| 79 | 333072 | 333287 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 80 | 1918079 | 1918297 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 81 | 783435 | 783629 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 82 | 2095793 | 2096011 | - | NZ_LR134379.1 | Slackia heliotrinireducens |
| 83 | 1029055 | 1029294 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 84 | 573831 | 574046 | - | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 85 | 307339 | 307554 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
| 86 | 187780 | 187998 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 87 | 4056502 | 4056720 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 88 | 1467659 | 1467877 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 89 | 322977 | 323171 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 90 | 408632 | 408850 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 91 | 3256303 | 3256521 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 92 | 313851 | 314069 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 93 | 179572 | 179790 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 94 | 221678 | 221896 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 95 | 1605959 | 1606177 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 96 | 3369656 | 3369874 | - | NZ_CP040840.1 | Leptospira weilii |
| 97 | 622510 | 622734 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 98 | 888912 | 889130 | + | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 99 | 2058045 | 2058263 | + | NZ_CP019082.1 | Paludisphaera borealis |
| 100 | 1609461 | 1609679 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 101 | 2106652 | 2106867 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 102 | 436693 | 436908 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 103 | 716729 | 716947 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 104 | 36676 | 36870 | + | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 105 | 145177 | 145371 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 106 | 979355 | 979576 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 107 | 2582 | 2800 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 108 | 706805 | 707023 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 109 | 641973 | 642155 | + | NZ_CP012117.1 | Dermabacter vaginalis |
| 110 | 729465 | 729647 | + | NZ_CP035504.1 | Kocuria indica |
| 111 | 680327 | 680548 | + | NZ_CP061538.1 | Rothia amarae |
| 112 | 169639 | 169860 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 113 | 169714 | 169935 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 114 | 918152 | 918355 | - | NZ_CP022316.1 | Brachybacterium avium |
| 115 | 1555278 | 1555481 | + | NZ_CP023563.1 | Brachybacterium vulturis |
| 116 | 1074362 | 1074565 | + | NZ_CP023564.1 | Brachybacterium ginsengisoli |
| 117 | 182206 | 182427 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 118 | 736438 | 736659 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 119 | 169994 | 170215 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 120 | 920090 | 920311 | + | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 121 | 2505831 | 2506034 | + | NZ_LN849456.1 | Devriesea agamarum |
| 122 | 1523906 | 1524109 | - | NC_012115.1 | Nautilia profundicola AmH |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_021283.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03118.17 | 0.65 | 79 | 1133 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
| 2 | PF01193.26 | 0.62 | 76 | 1102.0 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |
| 3 | PF01000.28 | 0.63 | 77 | 1133 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
++ More..