Result : Q5X8H6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CR628336.1 |
| Organism | Legionella pneumophila (strain Paris) |
| Left | 308681 |
| Right | 308893 |
| Strand | + |
| Nucleotide Sequence | ATGAACAACCAGCAAAAAATCAAATGCCCCATTTGTGGCAAGCAAAATACCTGGAGCCCTGATAACCAGTTCAGGCCTTTTTGCTCCGAACGATGCAAATTAATAGATCTGGGAGAATGGGCCAGCGAAAGCCGAAAAATTCCTGGAAGCTCCATTGATCCCGAGTCTATAGTGACAAGCAATAATAAGCAGGATAATGAGGATGAGCAGTAG |
| Sequence | MNNQQKIKCPICGKQNTWSPDNQFRPFCSERCKLIDLGEWASESRKIPGSSIDPESIVTSNNKQDNEDEQ |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 15467720 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q5X8H6 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 248791 | 249003 | + | NZ_CP013742.1 | Legionella pneumophila |
| 2 | 2090334 | 2090549 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 3 | 3051744 | 3051947 | + | NZ_LN681225.1 | Legionella hackeliae |
| 4 | 261663 | 261881 | - | NZ_CP025491.2 | Legionella sainthelensi |
| 5 | 859096 | 859290 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 6 | 592921 | 593124 | + | NZ_LT906442.1 | Legionella waltersii |
| 7 | 645635 | 645832 | - | NZ_CP025120.1 | Kangiella profundi |
| 8 | 650601 | 650798 | - | NZ_LR699119.1 | Aquicella siphonis |
| 9 | 2857072 | 2857260 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 10 | 472943 | 473161 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 11 | 512773 | 512973 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 12 | 4110751 | 4110969 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 13 | 1890282 | 1890479 | + | NZ_CP010975.1 | Kangiella geojedonensis |
| 14 | 735114 | 735317 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 15 | 4059400 | 4059582 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 16 | 3519471 | 3519659 | + | NZ_CP039287.1 | Cupriavidus necator H16 |
| 17 | 2216070 | 2216294 | - | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 18 | 1799732 | 1799950 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 19 | 463806 | 464000 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 20 | 2280444 | 2280635 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 21 | 2456095 | 2456283 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 22 | 2644393 | 2644584 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 23 | 2651159 | 2651347 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 24 | 3870149 | 3870343 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
++ More..