Result : Q5X846
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S14 |
| NCBI Accession ID | CR628336.1 |
| Organism | Legionella pneumophila (strain Paris) |
| Left | 462251 |
| Right | 462553 |
| Strand | + |
| Nucleotide Sequence | GTGGCTAAAAAATCAATGCTGATGCGAGAGTCAAAGCGTGCGAAGCTGGTAGAAAAGTACAGACAACGCCGAAACGAGTTAAAACAATTGATTAAATCATCTGATGATTTCCAGGTAATAATGGAAAGTCAGGCAAAACTAGCAAAACTACCAGTTAATTCAAATCCTGTTCGCTATGTTACTCGATGCAAGCAATGTGGAAGACCACACGCAGTTTATCGCAAGTTTAATCTTTGCAGAATTTGTTTAAGACAACAGCTTATGGTGGGCAATATCCCTGGCGGTAGAAAATCAAGCTGGTAA |
| Sequence | MAKKSMLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQAKLAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW |
| Source of smORF | Swiss-Prot |
| Function | Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site. {ECO:0000250}. |
| Pubmed ID | 15467720 |
| Domain | CDD:412331 |
| Functional Category | Metal-binding_and_Ribosomal_protein |
| Uniprot ID | Q5X846 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 107
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 389208 | 389510 | + | NZ_CP013742.1 | Legionella pneumophila |
| 2 | 569526 | 569828 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 3 | 6294 | 6596 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 4 | 3082054 | 3082356 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 5 | 657719 | 658021 | + | NZ_LT906442.1 | Legionella waltersii |
| 6 | 261121 | 261423 | + | NZ_LT906451.1 | Legionella lansingensis |
| 7 | 451637 | 451939 | + | NZ_LN614830.1 | Tatlockia micdadei |
| 8 | 342741 | 343043 | + | NZ_LN681225.1 | Legionella hackeliae |
| 9 | 2876421 | 2876723 | - | NZ_CP038254.1 | Legionella israelensis |
| 10 | 3803 | 4105 | - | NZ_LR134417.1 | Legionella adelaidensis |
| 11 | 2964309 | 2964611 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 12 | 2643067 | 2643369 | + | NZ_LR134374.1 | Legionella spiritensis |
| 13 | 549058 | 549363 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 14 | 428140 | 428445 | + | NZ_CP022132.1 | Francisella halioticida |
| 15 | 1250998 | 1251303 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 16 | 2734845 | 2735150 | - | NZ_CP072793.1 | Thiothrix unzii |
| 17 | 274284 | 274589 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 18 | 237704 | 238009 | + | NC_017449.1 | Francisella hispaniensis |
| 19 | 243433 | 243738 | + | NC_015696.1 | Francisella salina |
| 20 | 1550269 | 1550574 | - | NZ_CP043552.1 | Francisella marina |
| 21 | 257342 | 257647 | + | NZ_CP016796.1 | Francisella uliginis |
| 22 | 347411 | 347716 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 23 | 1479054 | 1479359 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 24 | 1550268 | 1550573 | - | NZ_CP038241.1 | Allofrancisella inopinata |
| 25 | 235538 | 235843 | + | NZ_CP022375.1 | Francisella opportunistica |
| 26 | 2124833 | 2125138 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 27 | 416078 | 416383 | + | NZ_CP025120.1 | Kangiella profundi |
| 28 | 3440685 | 3440990 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 29 | 512271 | 512576 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 30 | 153705 | 154010 | + | NZ_CP021781.1 | Francisella adeliensis |
| 31 | 1185370 | 1185675 | - | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 32 | 451557 | 451862 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 33 | 138134 | 138439 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 34 | 470130 | 470435 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 35 | 441734 | 442039 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 36 | 3622980 | 3623285 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 37 | 2116116 | 2116421 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 38 | 600626 | 600931 | + | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 39 | 1578976 | 1579281 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 40 | 2257638 | 2257943 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 41 | 385019 | 385324 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 42 | 141399 | 141704 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 43 | 3511932 | 3512237 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 44 | 368249 | 368554 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 45 | 259892 | 260197 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 46 | 5170737 | 5171042 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 47 | 2395530 | 2395835 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 48 | 173635 | 173940 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 49 | 3302658 | 3302963 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 50 | 6023963 | 6024268 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 51 | 460000 | 460305 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 52 | 2044819 | 2045124 | - | NZ_CP014841.1 | Dyella thiooxydans |
| 53 | 841540 | 841845 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 54 | 2011327 | 2011632 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 55 | 290716 | 291021 | + | NC_014532.2 | Halomonas elongata DSM 2581 |
| 56 | 2332385 | 2332690 | + | NZ_CP042218.1 | Luteimonas granuli |
| 57 | 759863 | 760168 | - | NZ_CP021323.1 | Kushneria konosiri |
| 58 | 3509298 | 3509603 | - | NZ_CP036422.1 | Halioglobus maricola |
| 59 | 838044 | 838352 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 60 | 752463 | 752768 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 61 | 371247 | 371552 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 62 | 4172832 | 4173137 | - | NZ_CP027860.1 | Ahniella affigens |
| 63 | 518029 | 518334 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 64 | 485752 | 486057 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 65 | 2539333 | 2539638 | + | NZ_CP021358.1 | Kushneria marisflavi |
| 66 | 332659 | 332964 | + | NZ_AP018933.1 | Zymobacter palmae |
| 67 | 2684121 | 2684426 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 68 | 2290548 | 2290853 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 69 | 365466 | 365771 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 70 | 3930149 | 3930454 | - | NZ_CP065435.1 | Halomonas sp. SS10-MC5 |
| 71 | 3637574 | 3637879 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 72 | 4411742 | 4412047 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 73 | 1094669 | 1094974 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 74 | 3922069 | 3922374 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 75 | 1969285 | 1969590 | + | NZ_CP018139.1 | Halomonas aestuarii |
| 76 | 981902 | 982207 | - | NZ_CP048812.1 | Halomonas socia |
| 77 | 259730 | 260035 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 78 | 2249751 | 2250056 | - | NZ_CP046415.1 | Guyparkeria halophila |
| 79 | 4337523 | 4337828 | - | NC_020911.1 | Octadecabacter antarcticus 307 |
| 80 | 507048 | 507353 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 81 | 374719 | 375024 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 82 | 3297470 | 3297775 | - | NZ_CP064030.1 | Dyella caseinilytica |
| 83 | 855863 | 856168 | - | NZ_CP015093.1 | Salipiger abyssi |
| 84 | 642855 | 643160 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 85 | 49818 | 50120 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 86 | 3513531 | 3513836 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 87 | 2916396 | 2916701 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 88 | 4400293 | 4400598 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 89 | 524089 | 524394 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 90 | 2549405 | 2549710 | - | NZ_CP003984.1 | Planktomarina temperata RCA23 |
| 91 | 3203638 | 3203943 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 92 | 1132017 | 1132322 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 93 | 2141259 | 2141564 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 94 | 483038 | 483343 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 95 | 4390833 | 4391138 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 96 | 4739309 | 4739614 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 97 | 4230392 | 4230697 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 98 | 3436079 | 3436384 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 99 | 3607238 | 3607543 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 100 | 2527392 | 2527697 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 101 | 339766 | 340071 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 102 | 3136733 | 3137038 | - | NZ_CP010650.1 | Phaeobacter inhibens |
| 103 | 305416 | 305721 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 104 | 1667042 | 1667347 | - | NZ_CP034328.1 | Tabrizicola piscis |
| 105 | 1347442 | 1347747 | + | NZ_AP019755.1 | Nitrosomonas stercoris |
| 106 | 524181 | 524486 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 107 | 1162514 | 1162819 | + | NZ_CP016268.1 | Woeseia oceani |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013742.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00831.25 | 0.96 | 103 | 1616 | same-strand | Ribosomal L29 protein |
| 2 | PF00366.22 | 0.98 | 105 | 1369 | same-strand | Ribosomal protein S17 |
| 3 | PF00238.21 | 0.98 | 105 | 903 | same-strand | Ribosomal protein L14p/L23e |
| 4 | PF17136.6 | 0.99 | 106 | 570.0 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00673.23 | 0.99 | 106 | 14.0 | same-strand | ribosomal L5P family C-terminus |
| 6 | PF00281.21 | 0.99 | 106 | 14.0 | same-strand | Ribosomal protein L5 |
| 7 | PF00410.21 | 0.99 | 106 | 24.0 | same-strand | Ribosomal protein S8 |
| 8 | PF00347.25 | 0.99 | 106 | 435.0 | same-strand | Ribosomal protein L6 |
| 9 | PF00861.24 | 0.96 | 103 | 982 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 10 | PF03719.17 | 0.99 | 106 | 1359.5 | same-strand | Ribosomal protein S5, C-terminal domain |
| 11 | PF00333.22 | 0.99 | 106 | 1359.5 | same-strand | Ribosomal protein S5, N-terminal domain |
| 12 | PF00327.22 | 0.93 | 99 | 1878 | same-strand | Ribosomal protein L30p/L7e |
++ More..