Result : Q5X4Y4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | CR628336.1 |
| Organism | Legionella pneumophila (strain Paris) |
| Left | 1709666 |
| Right | 1709905 |
| Strand | - |
| Nucleotide Sequence | GTGGACAATAGAGAAAAATCAAGGTTATTATGGAAATGCAGGCGAGGAATGCTAGAGCTTGATCTTCTTTTACAGAAATTCATAGCCAATGAGATTGATCGACTTACAGAAAATCAATTGAAAGCATTTGATAATCTATTAACCCACAATGACCCTAGTTTATATGCCTGGTTAATGGGGCATGAGGAACCCGAAAAAGAGTTGCTTGAAATTGTATCATTCATCAGAAACTGTGATTAA |
| Sequence | MDNREKSRLLWKCRRGMLELDLLLQKFIANEIDRLTENQLKAFDNLLTHNDPSLYAWLMGHEEPEKELLEIVSFIRNCD |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 15467720 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q5X4Y4 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1754110 | 1754349 | - | NZ_CP013742.1 | Legionella pneumophila |
| 2 | 1777337 | 1777579 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 3 | 1817108 | 1817350 | - | NZ_CP025491.2 | Legionella sainthelensi |
| 4 | 1793335 | 1793532 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 5 | 1615656 | 1615850 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 6 | 1620919 | 1621113 | + | NZ_LN681225.1 | Legionella hackeliae |
| 7 | 1323000 | 1323203 | + | NZ_LT906451.1 | Legionella lansingensis |
| 8 | 1482661 | 1482912 | + | NZ_CP038254.1 | Legionella israelensis |
| 9 | 1895347 | 1895589 | - | NZ_LT906442.1 | Legionella waltersii |
| 10 | 1544711 | 1544914 | + | NZ_LN614830.1 | Tatlockia micdadei |
| 11 | 2861254 | 2861454 | - | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 12 | 615177 | 615380 | + | NZ_CP028897.1 | Dongshaea marina |
| 13 | 2266508 | 2266708 | - | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 14 | 2693647 | 2693847 | - | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 15 | 881466 | 881666 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 16 | 2783897 | 2784097 | - | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 17 | 1736792 | 1737001 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 18 | 794647 | 794844 | + | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 19 | 756575 | 756775 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 20 | 817865 | 818065 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 21 | 2692015 | 2692215 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013742.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04542.16 | 0.86 | 18 | 2108.0 | same-strand | Sigma-70 region 2 |
| 2 | PF08281.14 | 0.86 | 18 | 2108.0 | same-strand | Sigma-70, region 4 |
| 3 | PF04545.18 | 0.76 | 16 | 2180.5 | same-strand | Sigma-70, region 4 |
++ More..