Result : Q5WSQ5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CR628337.1 |
| Organism | Legionella pneumophila (strain Lens) |
| Left | 3223155 |
| Right | 3223340 |
| Strand | + |
| Nucleotide Sequence | ATGGGATTAAGTGGAATAAGTCCGTTATCACTTTTATTAATTCTAGCCATTATTGTAGCCTTGTTTGGCACTTCCAAATTAAAAACAATCGGCTCTGACCTTGGTGAAGCGATTAAGAATTTCCGCAAAGCCATGAATAGTGAGGAAACAAATGACACTCAAAAGGACGATCATAAACCATCATGA |
| Sequence | MGLSGISPLSLLLILAIIVALFGTSKLKTIGSDLGEAIKNFRKAMNSEETNDTQKDDHKPS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15467720 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q5WSQ5 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3298892 | 3299077 | + | NZ_CP013742.1 | Legionella pneumophila |
| 2 | 333823 | 334005 | - | NZ_CP038254.1 | Legionella israelensis |
| 3 | 95434 | 95598 | - | NZ_LN681225.1 | Legionella hackeliae |
| 4 | 3658151 | 3658336 | + | NZ_LT906442.1 | Legionella waltersii |
| 5 | 2462976 | 2463170 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 6 | 4019417 | 4019602 | + | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 7 | 4130579 | 4130779 | + | NZ_CP036422.1 | Halioglobus maricola |
| 8 | 2291673 | 2291834 | + | NZ_LR134374.1 | Legionella spiritensis |
| 9 | 1413268 | 1413465 | + | NZ_LR134531.1 | Pragia fontium |
| 10 | 1122710 | 1122916 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 11 | 2390839 | 2391042 | - | NZ_LS483470.1 | Leminorella richardii |
| 12 | 3267684 | 3267884 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 13 | 3383506 | 3383715 | - | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 14 | 3308089 | 3308256 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 15 | 1176225 | 1176413 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 16 | 1286588 | 1286788 | + | NZ_CP061511.1 | Mixta calida |
| 17 | 1386848 | 1387048 | + | NZ_CP026377.1 | Mixta gaviniae |
| 18 | 3181709 | 3181882 | + | NZ_CP016397.1 | Legionella clemsonensis |
| 19 | 919190 | 919390 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 20 | 149704 | 149886 | - | NC_013861.1 | Legionella longbeachae NSW150 |
| 21 | 1315976 | 1316185 | + | NZ_CP025799.1 | Dickeya zeae |
| 22 | 3740090 | 3740272 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 23 | 717398 | 717598 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 24 | 3482024 | 3482233 | + | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 25 | 1377650 | 1377859 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 26 | 674726 | 674923 | + | NZ_CP015749.1 | Pectobacterium parmentieri |
| 27 | 2837378 | 2837578 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 28 | 3310376 | 3310573 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 29 | 2218283 | 2218438 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 30 | 2909937 | 2910146 | - | NZ_CP042220.2 | Dickeya poaceiphila |
| 31 | 2617113 | 2617313 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 32 | 50957 | 51118 | - | NZ_LT906451.1 | Legionella lansingensis |
| 33 | 1450425 | 1450622 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 34 | 2495905 | 2496108 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 35 | 1450053 | 1450250 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 36 | 3609039 | 3609236 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
| 37 | 242816 | 243013 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 38 | 2665752 | 2665955 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 39 | 1500659 | 1500856 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 40 | 214055 | 214252 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 41 | 3427118 | 3427315 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 42 | 4297118 | 4297288 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 43 | 279159 | 279317 | + | NZ_LR134433.1 | Legionella adelaidensis |
| 44 | 71755 | 71916 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 45 | 282968 | 283153 | - | NZ_CP045871.1 | Litoricola lipolytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034752.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00768.22 | 0.6 | 27 | 2508 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
| 2 | PF07943.15 | 0.6 | 27 | 2508 | opposite-strand | Penicillin-binding protein 5, C-terminal domain |
| 3 | PF04359.16 | 0.64 | 29 | 2108 | opposite-strand | Protein of unknown function (DUF493) |
| 4 | PF04055.23 | 0.64 | 29 | 104 | opposite-strand | Radical SAM superfamily |
++ More..