Result : Q5WHM5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein ABC1595 |
| NCBI Accession ID | AP006627.1 |
| Organism | Bacillus clausii (strain KSM-K16) |
| Left | 1720520 |
| Right | 1720807 |
| Strand | + |
| Nucleotide Sequence | ATGGCTCAAGAAGAAAAAGAGCGTTTTGTCATTCCAGATGAGAATGGCACAGAACATCTATTTGATGAATTGTTCCGTTTTACAGTTGACGAAACAGAAAAGTCGTATATGGTACTCGTTCCAGTCGGGGAAGAAGAGGATGACGAAGAGGAAGTCGAAGTGTTTGCGTTCCGTTATGAAGAACAGCAAAACGAAGACAATGATATTTCGTTTTATCCCGTTGAGACGGACGAAGAATGGGACATGATCGAAGAGATGCTTAATACTTTCTCTGAAGAGGAAGAGTAA |
| Sequence | MAQEEKERFVIPDENGTEHLFDELFRFTVDETEKSYMVLVPVGEEEDDEEEVEVFAFRYEEQQNEDNDISFYPVETDEEWDMIEEMLNTFSEEEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q5WHM5 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 815558 | 815851 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 2 | 1616777 | 1617064 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 3 | 2838791 | 2839090 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 4 | 1934482 | 1934769 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 5 | 2845570 | 2845857 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 6 | 1366537 | 1366818 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 7 | 2094002 | 2094286 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 8 | 2292296 | 2292580 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 9 | 2334714 | 2334992 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 10 | 1066890 | 1067174 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 11 | 2569006 | 2569290 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 12 | 1877636 | 1877920 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 13 | 1726033 | 1726323 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 14 | 1159927 | 1160214 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 15 | 1251976 | 1252236 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 16 | 174008 | 174316 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 17 | 2055836 | 2056156 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 18 | 3681260 | 3681580 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 19 | 3638060 | 3638380 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 20 | 3398987 | 3399268 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 21 | 2030112 | 2030390 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 22 | 1831044 | 1831331 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 23 | 1123133 | 1123417 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 24 | 1637230 | 1637466 | + | NZ_LS483476.1 | Lederbergia lentus |
| 25 | 3418854 | 3419135 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 26 | 3416161 | 3416448 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 27 | 1393356 | 1393667 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 28 | 1257092 | 1257379 | + | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017962.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01594.18 | 0.82 | 23 | 3827 | same-strand | AI-2E family transporter |
| 2 | PF01411.21 | 1.0 | 28 | 797.0 | same-strand | tRNA synthetases class II (A) |
| 3 | PF02272.21 | 1.0 | 28 | 797.0 | same-strand | DHHA1 domain |
| 4 | PF07973.16 | 1.0 | 28 | 797.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 5 | PF06135.14 | 1.0 | 28 | 433.5 | same-strand | IreB regulatory phosphoprotein |
| 6 | PF03652.17 | 1.0 | 28 | 16.0 | same-strand | Holliday junction resolvase |
| 7 | PF02618.18 | 1.0 | 28 | 235.0 | same-strand | YceG-like family |
| 8 | PF01596.19 | 1.0 | 28 | 1466.5 | same-strand | O-methyltransferase |
| 9 | PF13578.8 | 1.0 | 28 | 1466.5 | same-strand | Methyltransferase domain |
| 10 | PF00485.20 | 0.82 | 23 | 2133 | same-strand | Phosphoribulokinase / Uridine kinase family |
| 11 | PF13238.8 | 0.82 | 23 | 2133 | same-strand | AAA domain |
| 12 | PF03449.17 | 0.75 | 21 | 2886 | same-strand | Transcription elongation factor, N-terminal |
| 13 | PF01272.21 | 0.75 | 21 | 2886 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
++ More..