Result : Q5WFA1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit epsilon (RNAP epsilon subunit) (EC 2.7.7.6) (RNA polymerase epsilon subunit) (Transcriptase subunit epsilon) |
| NCBI Accession ID | AP006627.1 |
| Organism | Bacillus clausii (strain KSM-K16) |
| Left | 2552806 |
| Right | 2553015 |
| Strand | + |
| Nucleotide Sequence | ATGATTTTTAAAGTTTACTATCAAGAAGATGCCGCGCAGATGCCTGTACGGGAACGGACAAAGTCATTGTACATAGAAGGCGAAAGCGAAGCAGACGTCCGCCTTAAGTTGGCCAAGCAAAACTTCAACATTGAATACGTAACAGCTGTAACTGGAGCATATTTAGAATATGAGCAGGCAAACAGCGACTTTAAGGTCGTGAACATTTAA |
| Sequence | MIFKVYYQEDAAQMPVRERTKSLYIEGESEADVRLKLAKQNFNIEYVTAVTGAYLEYEQANSDFKVVNI |
| Source of smORF | Swiss-Prot |
| Function | A non-essential component of RNA polymerase (RNAP). {ECO:0000255|HAMAP-Rule:MF_01553}. |
| Pubmed ID | |
| Domain | CDD:416298 |
| Functional Category | Others |
| Uniprot ID | Q5WFA1 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4075146 | 4075355 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 2 | 5111218 | 5111430 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 3 | 1430105 | 1430314 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2492394 | 2492603 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 5 | 1496511 | 1496720 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 1489902 | 1490111 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 1524791 | 1525000 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 8 | 1600520 | 1600729 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 9 | 296506 | 296718 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 10 | 2918795 | 2919004 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 11 | 1661970 | 1662179 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 12 | 1528341 | 1528550 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 13 | 460566 | 460775 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 14 | 1103206 | 1103415 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 15 | 1701709 | 1701918 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 16 | 1294853 | 1295062 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 17 | 2024548 | 2024760 | - | NZ_CP053989.1 | Niallia circulans |
| 18 | 2530455 | 2530664 | + | NZ_CP011937.1 | Bacillus velezensis |
| 19 | 1427958 | 1428167 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 20 | 2756094 | 2756306 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 21 | 474764 | 474973 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 22 | 2900110 | 2900325 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 23 | 2287018 | 2287233 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 24 | 1080525 | 1080740 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 25 | 175647 | 175862 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 26 | 525305 | 525520 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 903294 | 903509 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 28 | 1323695 | 1323904 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 29 | 2880465 | 2880674 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 30 | 3994989 | 3995201 | + | NC_011725.1 | Bacillus cereus B4264 |
| 31 | 3835134 | 3835346 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 32 | 2781564 | 2781773 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 33 | 1087026 | 1087235 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 34 | 2063897 | 2064112 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 35 | 2539068 | 2539277 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 36 | 1369178 | 1369390 | - | NZ_CP040336.1 | Bacillus luti |
| 37 | 1906702 | 1906914 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 38 | 1410817 | 1411026 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 39 | 2087234 | 2087449 | + | NZ_CP016538.2 | Planococcus maritimus |
| 40 | 2109803 | 2110018 | + | NZ_CP059540.1 | Planococcus maritimus |
| 41 | 3911331 | 3911540 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 42 | 1882282 | 1882497 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 43 | 2711509 | 2711721 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 44 | 3863367 | 3863579 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 45 | 1076014 | 1076223 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 46 | 1234149 | 1234358 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 47 | 4001871 | 4002083 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 48 | 874147 | 874356 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 49 | 3795563 | 3795772 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 50 | 1424355 | 1424564 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 51 | 272609 | 272818 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 52 | 2562135 | 2562344 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 53 | 109231 | 109440 | + | NZ_CP043404.1 | Bacillus safensis |
| 54 | 2170389 | 2170598 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 55 | 1550251 | 1550460 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 56 | 1846114 | 1846323 | + | NZ_LR134483.1 | Listeria grayi |
| 57 | 1913514 | 1913723 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 58 | 2667844 | 2668053 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 59 | 2221915 | 2222124 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 60 | 3407087 | 3407296 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 61 | 2212029 | 2212241 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 62 | 2316441 | 2316653 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 63 | 2226032 | 2226244 | + | NZ_CP016540.2 | Planococcus versutus |
| 64 | 3414182 | 3414391 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 65 | 4261 | 4467 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 66 | 2901595 | 2901807 | - | NZ_CP013661.2 | Planococcus kocurii |
| 67 | 1806877 | 1807086 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 68 | 1570806 | 1571015 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 69 | 1072280 | 1072489 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 70 | 1057067 | 1057276 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 71 | 1218852 | 1219058 | - | NZ_CP012024.1 | Bacillus smithii |
| 72 | 2706876 | 2707088 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 73 | 973075 | 973284 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 74 | 2362010 | 2362222 | + | NZ_CP019401.1 | Planococcus faecalis |
| 75 | 1401556 | 1401771 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 76 | 1031857 | 1032066 | - | NZ_LT906444.1 | Listeria welshimeri |
| 77 | 1592283 | 1592498 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 78 | 2503385 | 2503597 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 79 | 1431602 | 1431811 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 80 | 2798708 | 2798920 | + | NZ_LS483476.1 | Lederbergia lentus |
| 81 | 3244687 | 3244896 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 82 | 1151173 | 1151385 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 83 | 701448 | 701663 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 84 | 2911449 | 2911658 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 85 | 1671073 | 1671282 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 86 | 2035106 | 2035318 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 87 | 2095969 | 2096181 | + | NZ_CP065211.1 | Enterococcus lactis |
| 88 | 528885 | 529055 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 89 | 243851 | 244066 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 90 | 655117 | 655329 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 91 | 1829352 | 1829564 | + | NZ_CP016843.1 | Carnobacterium divergens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016622.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02254.20 | 0.84 | 76 | 1781 | opposite-strand | TrkA-N domain |
| 2 | PF02080.23 | 0.84 | 76 | 1781 | opposite-strand | TrkA-C domain |
| 3 | PF17770.3 | 0.99 | 89 | 4.0 | same-strand | Ribonuclease J C-terminal domain |
| 4 | PF08282.14 | 0.79 | 71 | 448.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF01327.23 | 0.84 | 76 | 1216 | same-strand | Polypeptide deformylase |
| 6 | PF10368.11 | 0.68 | 61 | 2013.5 | opposite-strand | Putative cell-wall binding lipoprotein |
| 7 | PF00676.22 | 0.82 | 74 | 2779 | opposite-strand | Dehydrogenase E1 component |
| 8 | PF02780.22 | 0.6 | 54 | 3851 | opposite-strand | Transketolase, C-terminal domain |
| 9 | PF02779.26 | 0.6 | 54 | 3851 | opposite-strand | Transketolase, pyrimidine binding domain |
++ More..