Result : Q5WD36
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein Tlp |
| NCBI Accession ID | AP006627.1 |
| Organism | Bacillus clausii (strain KSM-K16) |
| Left | 3312694 |
| Right | 3312924 |
| Strand | - |
| Nucleotide Sequence | ATGGCCAAAAGAGATGACCGCTCCAATAATCCAGAAAGAATTGAAAATATAATTGGCAACACGCTACAAAACATGGATGAGGCTAGAGATTATGCCAAAGCTCATTCAGAGGAGCTAAGTGAGGAAGAAAAACAGGAGATTGAACAAAAAAATGAACGCCGTGAGCAAAGTATCGACGGCTTACGCGAAGAATTAAAAGACGAAGTCAATGACCAAAAGAACAACAGCTAA |
| Sequence | MAKRDDRSNNPERIENIIGNTLQNMDEARDYAKAHSEELSEEEKQEIEQKNERREQSIDGLREELKDEVNDQKNNS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
| Pubmed ID | |
| Domain | CDD:186720 |
| Functional Category | Others |
| Uniprot ID | Q5WD36 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 25
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3461522 | 3461752 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 2 | 1092669 | 1092890 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 3 | 86121 | 86348 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 4 | 3378608 | 3378835 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 5 | 3291878 | 3292105 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 6 | 198671 | 198895 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 7 | 2727489 | 2727716 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 8 | 2410738 | 2410959 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 9 | 3098810 | 3099034 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 10 | 3304523 | 3304756 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 11 | 2793870 | 2794088 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 12 | 6966887 | 6967111 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 13 | 1680636 | 1680860 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 14 | 7704112 | 7704336 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 15 | 332236 | 332424 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 16 | 396742 | 396927 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 17 | 1998207 | 1998464 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 18 | 284268 | 284456 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 19 | 5528622 | 5528846 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 20 | 3040598 | 3040813 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 21 | 4718820 | 4719029 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 22 | 346436 | 346633 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 23 | 1779861 | 1780103 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 24 | 1596480 | 1596704 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 25 | 3545707 | 3545949 | - | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..