Result : A8GMC1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000847.1 |
| Organism | Rickettsia akari (strain Hartford) |
| Left | 209385 |
| Right | 209687 |
| Strand | - |
| Nucleotide Sequence | ATGATTACAAAAGAAGAAGCACGAAAAATAGCAAAATTAGCTAGATTAAAATTTGAAAAAGATACTGTAGAAAAATTTTCTACTCAGCTTGGCACTATTATGGATATGATCGATATTTTAAATGAAATAGATTGCAAAGATATAGAGCCTCTAACCTCAGTGTCTAATATGAATGCTAGAATGCGAGAGGACGCCGTTACAAGTTCTGATTTATCAAACAAATTATTTGATAATGTAAGCGGAAATAGTGCGCAGCTTGCTAAAGAAGTAAAATATTTTATCACTCCAAAGGTTGTTGAATAA |
| Sequence | MITKEEARKIAKLARLKFEKDTVEKFSTQLGTIMDMIDILNEIDCKDIEPLTSVSNMNARMREDAVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVVE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A8GMC1 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 209385 | 209687 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 2 | 208556 | 208858 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 3 | 1246825 | 1247127 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 4 | 235200 | 235502 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 5 | 206840 | 207142 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 6 | 181823 | 182125 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 7 | 184453 | 184755 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 8 | 203286 | 203588 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 9 | 568865 | 569167 | - | NZ_LN794217.1 | Rickettsia monacensis |
| 10 | 205740 | 206042 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 11 | 181880 | 182182 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 12 | 1222995 | 1223297 | + | NC_007940.1 | Rickettsia bellii RML369-C |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009881.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05173.16 | 1.0 | 12 | 4665.5 | same-strand | Dihydrodipicolinate reductase, C-terminus |
| 2 | PF01113.22 | 1.0 | 12 | 4665.5 | same-strand | Dihydrodipicolinate reductase, N-terminus |
| 3 | PF01613.20 | 1.0 | 12 | 3905.5 | same-strand | Flavin reductase like domain |
| 4 | PF00497.22 | 1.0 | 12 | 3195.5 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 5 | PF02934.17 | 1.0 | 12 | 1487.0 | same-strand | GatB/GatE catalytic domain |
| 6 | PF02637.20 | 1.0 | 12 | 1487.0 | same-strand | GatB domain |
| 7 | PF01425.23 | 1.0 | 12 | 3.0 | same-strand | Amidase |
| 8 | PF01765.21 | 1.0 | 12 | 552.5 | same-strand | Ribosome recycling factor |
| 9 | PF00696.30 | 1.0 | 12 | 1325.5 | same-strand | Amino acid kinase family |
++ More..