Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | CP000847.1 |
Organism | Rickettsia akari (strain Hartford) |
Left | 209385 |
Right | 209687 |
Strand | - |
Nucleotide Sequence | ATGATTACAAAAGAAGAAGCACGAAAAATAGCAAAATTAGCTAGATTAAAATTTGAAAAAGATACTGTAGAAAAATTTTCTACTCAGCTTGGCACTATTATGGATATGATCGATATTTTAAATGAAATAGATTGCAAAGATATAGAGCCTCTAACCTCAGTGTCTAATATGAATGCTAGAATGCGAGAGGACGCCGTTACAAGTTCTGATTTATCAAACAAATTATTTGATAATGTAAGCGGAAATAGTGCGCAGCTTGCTAAAGAAGTAAAATATTTTATCACTCCAAAGGTTGTTGAATAA |
Sequence | MITKEEARKIAKLARLKFEKDTVEKFSTQLGTIMDMIDILNEIDCKDIEPLTSVSNMNARMREDAVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVVE |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | A8GMC1 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 209385 | 209687 | - | NC_009881.1 | Rickettsia akari str. Hartford |
2 | 208556 | 208858 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
3 | 1246825 | 1247127 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
4 | 235200 | 235502 | - | NZ_AP019563.1 | Rickettsia asiatica |
5 | 206840 | 207142 | - | NC_016639.1 | Rickettsia slovaca 13-B |
6 | 181823 | 182125 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
7 | 184453 | 184755 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
8 | 203286 | 203588 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
9 | 568865 | 569167 | - | NZ_LN794217.1 | Rickettsia monacensis |
10 | 205740 | 206042 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
11 | 181880 | 182182 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
12 | 1222995 | 1223297 | + | NC_007940.1 | Rickettsia bellii RML369-C |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05173.16 | 1.0 | 12 | 4665.5 | same-strand | Dihydrodipicolinate reductase, C-terminus |
2 | PF01113.22 | 1.0 | 12 | 4665.5 | same-strand | Dihydrodipicolinate reductase, N-terminus |
3 | PF01613.20 | 1.0 | 12 | 3905.5 | same-strand | Flavin reductase like domain |
4 | PF00497.22 | 1.0 | 12 | 3195.5 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
5 | PF02934.17 | 1.0 | 12 | 1487.0 | same-strand | GatB/GatE catalytic domain |
6 | PF02637.20 | 1.0 | 12 | 1487.0 | same-strand | GatB domain |
7 | PF01425.23 | 1.0 | 12 | 3.0 | same-strand | Amidase |
8 | PF01765.21 | 1.0 | 12 | 552.5 | same-strand | Ribosome recycling factor |
9 | PF00696.30 | 1.0 | 12 | 1325.5 | same-strand | Amino acid kinase family |