Result : Q5WAH3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AP006627.1 |
| Organism | Bacillus clausii (strain KSM-K16) |
| Left | 4289357 |
| Right | 4289644 |
| Strand | - |
| Nucleotide Sequence | ATGCGTAAGTATGAAATTATGTACATTATCGCTCCAAACCTAGAAGAATCAGCAAACAAGGAAATCATTGAGCGTTACAACAAAGTGCTCACTGACAACGGTGCTGAAATTCTAAAGGTGGACGAGATCGGTAAAAAACGCCTAGCTTATGAAATCAACGATTTCAAAGATGGTTTCTATGTATTGCTAAGTGTACAAGCAAATACGGAAGCGATTAACGAGTTTAACCGTTTGATTAAAATCAACGACAACGTTATCCGCGTTCTCGTAACAAAAGACGAACAGTAA |
| Sequence | MRKYEIMYIIAPNLEESANKEIIERYNKVLTDNGAEILKVDEIGKKRLAYEINDFKDGFYVLLSVQANTEAINEFNRLIKINDNVIRVLVTKDEQ |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q5WAH3 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 144
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3843398 | 3843685 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 2 | 4186737 | 4187024 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 3 | 4665046 | 4665336 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 4 | 1425357 | 1425644 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 3613959 | 3614246 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 6 | 2843495 | 2843782 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 7 | 5021175 | 5021462 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 8 | 1013569 | 1013856 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 9 | 2152126 | 2152413 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 10 | 1911236 | 1911523 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 11 | 1574730 | 1575020 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 12 | 4207787 | 4208074 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 11816 | 12103 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 5214543 | 5214833 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 15 | 5406149 | 5406439 | - | NC_011725.1 | Bacillus cereus B4264 |
| 16 | 4069504 | 4069791 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 17 | 5132496 | 5132786 | + | NZ_CP040336.1 | Bacillus luti |
| 18 | 119654 | 119941 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 19 | 3995771 | 3996058 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 20 | 3851016 | 3851306 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 21 | 5237615 | 5237905 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 5435100 | 5435390 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 23 | 4199445 | 4199732 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 24 | 4029022 | 4029309 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 25 | 368755 | 369045 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 26 | 4591904 | 4592191 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 27 | 1218576 | 1218866 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 28 | 3022596 | 3022883 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 29 | 2427239 | 2427523 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 30 | 2586035 | 2586319 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 19018 | 19305 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 32 | 4103376 | 4103663 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 33 | 2556073 | 2556360 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 34 | 4867301 | 4867588 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 35 | 4014653 | 4014940 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 36 | 2025551 | 2025838 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 37 | 17502 | 17789 | + | NZ_CP011937.1 | Bacillus velezensis |
| 38 | 4010613 | 4010900 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 39 | 4580285 | 4580572 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 40 | 89786 | 90076 | - | NZ_CP053989.1 | Niallia circulans |
| 41 | 1722589 | 1722879 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 42 | 2289748 | 2290035 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 43 | 4199816 | 4200106 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 44 | 2104594 | 2104881 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 45 | 2327953 | 2328243 | - | NZ_CP047361.1 | Macrococcus canis |
| 46 | 3713999 | 3714289 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 47 | 3599265 | 3599555 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 48 | 4896165 | 4896452 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 49 | 323548 | 323838 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 50 | 2346562 | 2346852 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 51 | 4364694 | 4364981 | - | NZ_LS483476.1 | Lederbergia lentus |
| 52 | 4086094 | 4086384 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 53 | 1661149 | 1661436 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 54 | 1564748 | 1565035 | + | NZ_CP043404.1 | Bacillus safensis |
| 55 | 4213635 | 4213922 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 56 | 2247793 | 2248083 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 57 | 4294948 | 4295235 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 58 | 3172742 | 3173029 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 59 | 2731552 | 2731842 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 60 | 2790355 | 2790642 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 61 | 3114451 | 3114720 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 62 | 3265789 | 3266076 | - | NZ_CP016538.2 | Planococcus maritimus |
| 63 | 3267818 | 3268105 | - | NZ_CP059540.1 | Planococcus maritimus |
| 64 | 3246784 | 3247071 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 65 | 3728400 | 3728687 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 66 | 3990750 | 3991037 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 67 | 2808082 | 2808369 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 68 | 250204 | 250491 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 69 | 2118748 | 2119035 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 70 | 4646634 | 4646924 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 71 | 95059 | 95349 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 72 | 2184680 | 2184967 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 73 | 49606 | 49878 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 74 | 3354457 | 3354744 | - | NZ_CP012024.1 | Bacillus smithii |
| 75 | 34261 | 34533 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 76 | 35504 | 35776 | + | NZ_LT906444.1 | Listeria welshimeri |
| 77 | 103041 | 103313 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 78 | 2076441 | 2076737 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 79 | 3293087 | 3293392 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 80 | 160485 | 160790 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 81 | 3290693 | 3290980 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 82 | 3410041 | 3410328 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 83 | 24839 | 25138 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 84 | 2602507 | 2602794 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 85 | 53725 | 54021 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 86 | 2438633 | 2438929 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 87 | 40949 | 41236 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 88 | 6644542 | 6644829 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 89 | 3280879 | 3281151 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 90 | 362326 | 362622 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 91 | 360630 | 360926 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 92 | 1777782 | 1778069 | + | NZ_CP013661.2 | Planococcus kocurii |
| 93 | 3481174 | 3481461 | - | NZ_CP019401.1 | Planococcus faecalis |
| 94 | 3750735 | 3751022 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 95 | 1713849 | 1714139 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 96 | 208340 | 208609 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 97 | 387377 | 387673 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 98 | 3244848 | 3245135 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 99 | 2361980 | 2362276 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 100 | 1568267 | 1568563 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 101 | 1879439 | 1879726 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 102 | 573589 | 573876 | + | NZ_CP026363.1 | Brevibacillus agri |
| 103 | 33267 | 33563 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 104 | 2482727 | 2483032 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 105 | 701793 | 702086 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 106 | 1347976 | 1348272 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 107 | 2548304 | 2548600 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 108 | 224136 | 224408 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 109 | 959115 | 959411 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 110 | 2196183 | 2196479 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 111 | 3246272 | 3246556 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 112 | 2416483 | 2416776 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 113 | 4121734 | 4122006 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 114 | 2415042 | 2415338 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 115 | 813359 | 813655 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 116 | 3235014 | 3235301 | - | NZ_CP016540.2 | Planococcus versutus |
| 117 | 4314877 | 4315170 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 118 | 2635554 | 2635850 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 119 | 1374855 | 1375151 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 120 | 1045247 | 1045537 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 121 | 46891 | 47178 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 122 | 33069 | 33341 | + | NZ_LR134483.1 | Listeria grayi |
| 123 | 1150064 | 1150354 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 124 | 255624 | 255896 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 125 | 147862 | 148134 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 126 | 612824 | 613111 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 127 | 4212923 | 4213207 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 128 | 579134 | 579403 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 129 | 4294942 | 4295226 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 130 | 1874154 | 1874441 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 131 | 8877 | 9152 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 132 | 165840 | 166124 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 133 | 9057 | 9341 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 134 | 3641420 | 3641704 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 135 | 6477769 | 6478053 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 136 | 775816 | 776100 | - | NZ_CP034437.1 | Paenibacillus albus |
| 137 | 1693849 | 1694139 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 138 | 2528769 | 2529059 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 139 | 2208025 | 2208276 | + | NZ_CP049366.1 | Companilactobacillus pabuli |
| 140 | 345748 | 346035 | + | NC_022549.1 | Acholeplasma brassicae |
| 141 | 8946 | 9197 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 142 | 2253616 | 2253867 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 143 | 442424 | 442714 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 144 | 70304 | 70555 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 145 | 6018769 | 6019053 | - | NZ_CP009288.1 | Paenibacillus durus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013791.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01084.22 | 1.0 | 144 | 596 | same-strand | Ribosomal protein S18 |
| 2 | PF00436.27 | 1.0 | 144 | 37 | same-strand | Single-strand binding protein family |
| 3 | PF06071.15 | 0.76 | 109 | 277.0 | same-strand | Protein of unknown function (DUF933) |
| 4 | PF06107.13 | 0.74 | 107 | 1672.0 | same-strand | Bacterial protein of unknown function (DUF951) |
++ More..