| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable acyl carrier protein PigG (Peptidyl carrier protein) (PCP) |
| NCBI Accession ID | AJ833001.1 |
| Organism | Serratia sp. (strain ATCC 39006) |
| Left | 13924 |
| Right | 14187 |
| Strand | + |
| Nucleotide Sequence | ATGTTAGAAAGTAAATTGATAAACCATATTGCTACTCAGTTTTTGGATGGTGAAAAGGATGGCCTGGATAGCCAAACACCCTTGTTTGAGCTGAATATAGTTGACTCGGCTGCAATTTTTGATCTGGTGGATTTTTTAAGGCAAGAGAGCAAGGTCTCGATTGGCATGCAAGAGATTCACCCGGCAAATTTCGCCACCGTGCAGAGTATGGTTGCGCTGGTGCAACGGCTGAAGGCGCATCCGGAGCAGGGAGGTGCGGCATGA |
| Sequence | MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRLKAHPEQGGAA |
| Source of smORF | Swiss-Prot |
| Function | Involved in the biosynthesis of 4-methoxy-2,2'-bipyrrole-5-carbaldehyde (MBC), one of the terminal products involved in the biosynthesis of the red antibiotic prodigiosin (Pig). Carrier of the L-prolyl group transferred from L-prolyl-AMP by PigI. {ECO:0000269|Pubmed:15853884, ECO:0000269|Pubmed:17002325}. |
| Pubmed ID | 15528645 15853884 17002325 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q5W265 |
| ORF Length (Amino Acid) | 87 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 473516 | 473779 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 2 | 1180010 | 1180273 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 3 | 1248070 | 1248318 | - | NZ_CP065640.1 | Serratia rubidaea |
| 4 | 1897082 | 1897345 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 5 | 4147402 | 4147650 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 6 | 683011 | 683274 | + | NZ_CP072135.1 | Pseudoalteromonas xiamenensis |
| 7 | 1878531 | 1878794 | + | NZ_CP046268.1 | Vibrio spartinae |
| 8 | 7028428 | 7028649 | - | NZ_CP031194.1 | Streptomyces paludis |
| 9 | 8906454 | 8906675 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11639.10 | 0.67 | 6 | 5760.5 | same-strand | REDY-like protein HapK |
| 2 | PF00109.28 | 0.89 | 8 | 3440.0 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 3 | PF02801.24 | 1.0 | 9 | 3443 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 4 | PF00501.30 | 1.0 | 9 | 1961 | same-strand | AMP-binding enzyme |
| 5 | PF13193.8 | 0.89 | 8 | 1959.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 6 | PF00155.23 | 1.0 | 9 | -3 | same-strand | Aminotransferase class I and II |
| 7 | PF00550.27 | 1.0 | 9 | 4.5 | same-strand | Phosphopantetheine attachment site |
| 8 | PF00891.20 | 0.78 | 7 | 15 | same-strand | O-methyltransferase domain |
| 9 | PF16864.7 | 0.78 | 7 | 15 | same-strand | Dimerisation domain |
| 10 | PF08242.14 | 1.0 | 9 | 24 | same-strand | Methyltransferase domain |
| 11 | PF08241.14 | 0.78 | 7 | 24 | same-strand | Methyltransferase domain |
| 12 | PF13649.8 | 0.89 | 8 | 24.0 | same-strand | Methyltransferase domain |
| 13 | PF00202.23 | 0.67 | 6 | 1052.5 | same-strand | Aminotransferase class-III |
| 14 | PF01326.21 | 0.78 | 7 | 6381 | same-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
| 15 | PF00391.25 | 0.78 | 7 | 6381 | same-strand | PEP-utilising enzyme, mobile domain |
| 16 | PF19507.1 | 0.89 | 8 | 9046.0 | same-strand | Family of unknown function (DUF6041) |