| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ribosome-binding factor A (30S ribosome-binding protein) |
| NCBI Accession ID | AP008226.1 |
| Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
| Left | 867479 |
| Right | 867766 |
| Strand | + |
| Nucleotide Sequence | ATGGCTTACGGCAAGGCCCACCTCGAGGCCCAGTTGAAGCGCGCCCTCGCGGAGGAGATCCAGGCCCTCGAGGACCCCAGGCTCTTCCTCCTCACCGTGGAGGCGGTGCGCCTTTCCAAGGACGGGAGCGTCCTCTCGGTCTACGTGGAGGCCTTCCGGGAGGAAGAGGGGGCCCTGCGGGCCCTCTCCCGGGCCGAGCGCCGGCTTGTGGCCGCCCTTGCCCGGAGGGTCCGCATGCGCCGCCTGCCCCGCCTGGAGTTCCTGCCGTGGAGAGCGTCACCCGCATAA |
| Sequence | MAYGKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASPA |
| Source of smORF | Swiss-Prot |
| Function | One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes) (Pubmed:17996707). Required for efficient processing of 16S rRNA. Probably interacts with the 5'-terminal helix region of 16S rRNA, bringing together different domains of the 30S ribosomal subunit which aids assembly (Pubmed:17996707). {ECO:0000269|Pubmed:17996707}. |
| Pubmed ID | 17996707 |
| Domain | |
| Functional Category | RNA-binding |
| Uniprot ID | Q5SJV1 |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 867479 | 867766 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 1123234 | 1123521 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 294036 | 294323 | + | NZ_CP038452.1 | Thermus caldilimi |
| 4 | 870879 | 871157 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 5 | 222897 | 223151 | - | NZ_CP016312.1 | Thermus brockianus |
| 6 | 624062 | 624346 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03061.24 | 1.0 | 6 | -21.0 | same-strand | Thioesterase superfamily |
| 2 | PF13279.8 | 1.0 | 6 | -21.0 | same-strand | Thioesterase-like superfamily |
| 3 | PF00202.23 | 0.83 | 5 | 388 | same-strand | Aminotransferase class-III |
| 4 | PF00773.21 | 1.0 | 6 | 1631.0 | same-strand | RNB domain |
| 5 | PF17876.3 | 1.0 | 6 | 1631.0 | same-strand | Cold shock domain |
| 6 | PF08206.13 | 1.0 | 6 | 1631.0 | same-strand | Ribonuclease B OB domain |
| 7 | PF00575.25 | 0.83 | 5 | 1633 | same-strand | S1 RNA binding domain |
| 8 | PF01875.19 | 0.83 | 5 | 3856 | opposite-strand | Memo-like protein |
| 9 | PF09339.12 | 0.67 | 4 | 1631.0 | same-strand | IclR helix-turn-helix domain |
| 10 | PF01966.24 | 0.67 | 4 | 4942.0 | opposite-strand | HD domain |
| 11 | PF12627.9 | 0.67 | 4 | 4942.0 | opposite-strand | Probable RNA and SrmB- binding site of polymerase A |