Result : Q5SI26
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamine synthetase and cystathionine beta-lyase binding protein (GCBP) |
| NCBI Accession ID | AP008226.1 |
| Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
| Left | 1480055 |
| Right | 1480342 |
| Strand | + |
| Nucleotide Sequence | ATGCCCACCTTTATCGTCCTCAGCACCCTGACCGACGACGGAGCCGAGACCCTGGTGAAGAACCCCGAGCGCATCAAGGAGGTGAACCAGGAGCTGGAGCGGGACTTCGGGGTCAGGGTGGTGGCCCAGTACGCCGTGCTCGGGCCCTACGACTTCGTGAACGTCGTGGAGGCGGAGGACGCCGCCACCGTGGCCCGGGCCATGCTCCACCTGGCCTCCCGGGGAAGCGTGAAGACGATGACCCTCGAGGCCATCCCCGTGGCCGACCTCATCGCCCGGCTCAAGTAG |
| Sequence | MPTFIVLSTLTDDGAETLVKNPERIKEVNQELERDFGVRVVAQYAVLGPYDFVNVVEAEDAATVARAMLHLASRGSVKTMTLEAIPVADLIARLK |
| Source of smORF | Swiss-Prot |
| Function | Binds to glutamine synthetase and cystathionine beta-lyase. May be utilized for the efficient use of nitrogen in the global nitrogen regulation of T.thermophilus. {ECO:0000269|Pubmed:15893507}. |
| Pubmed ID | 15893507 |
| Domain | CDD:413040 |
| Functional Category | Others |
| Uniprot ID | Q5SI26 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1480055 | 1480342 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 518439 | 518726 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 1403707 | 1403994 | - | NZ_CP016312.1 | Thermus brockianus |
| 4 | 598458 | 598745 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 5 | 1653488 | 1653775 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 6 | 1203854 | 1204141 | + | NZ_CP038452.1 | Thermus caldilimi |
| 7 | 609371 | 609679 | - | NC_011961.1 | Thermomicrobium roseum DSM 5159 |
| 8 | 32119 | 32394 | + | NZ_CP006577.1 | Archaeoglobus fulgidus DSM 8774 |
| 9 | 1330418 | 1330705 | + | NC_013849.1 | Ferroglobus placidus DSM 10642 |
| 10 | 885976 | 886263 | - | NZ_CP011267.1 | Geoglobus ahangari |
| 11 | 448196 | 448516 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 12 | 1195453 | 1195746 | - | NZ_CP007028.1 | Thermocrinis ruber |
| 13 | 1423818 | 1424114 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 14 | 1119211 | 1119495 | - | NC_015676.1 | Methanosalsum zhilinae DSM 4017 |
| 15 | 584649 | 584948 | - | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 16 | 2083528 | 2083812 | - | NC_014253.1 | Methanohalobium evestigatum Z-7303 |
| 17 | 873604 | 873894 | - | NC_013524.1 | Sphaerobacter thermophilus DSM 20745 |
| 18 | 1059063 | 1059344 | + | NZ_CP042430.1 | Baekduia soli |
| 19 | 1195907 | 1196233 | + | NC_003364.1 | Pyrobaculum aerophilum str. IM2 |
| 20 | 696391 | 696681 | + | NC_016645.1 | Pyrobaculum ferrireducens |
| 21 | 2829875 | 2830165 | - | NZ_CP029289.2 | Acidianus brierleyi |
| 22 | 844512 | 844793 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 23 | 853747 | 854058 | + | NZ_CP020364.1 | Sulfolobus acidocaldarius |
| 24 | 1329284 | 1329571 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 25 | 896498 | 896782 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 26 | 747237 | 747557 | + | NZ_CP077717.1 | Saccharolobus shibatae B12 |
| 27 | 455252 | 455572 | - | NZ_CP033238.1 | Saccharolobus solfataricus |
| 28 | 1087623 | 1087859 | - | NC_009376.1 | Pyrobaculum arsenaticum DSM 13514 |
| 29 | 1835508 | 1835831 | - | NZ_CP049074.1 | Metallosphaera tengchongensis |
++ More..