Result : Q5QWP6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein IL1825 |
| NCBI Accession ID | AE017340.1 |
| Organism | Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) |
| Left | 1958308 |
| Right | 1958568 |
| Strand | - |
| Nucleotide Sequence | ATGCTGTGTGATGTTTATCGCAGCTCGAAAAAAGCCGATACCTATCTTTACCTGCCTCATGGTAACGAATTTACCGACGTGCCCGATGTTTTGTTGGGCCAGTTTGGTCGCGCCGAAAAAGTGCTGACAATTAACCTGGCCAACCGTGAACAGTTGGCGCGTTTAACGGTCGAAAAGTTACAACAGCATTTGCATAACGATGGTTTCTATTTGCAGTTACCACCGAAACGAGAGGAACTTCAAGTCAATGTTAACAAATAA |
| Sequence | MLCDVYRSSKKADTYLYLPHGNEFTDVPDVLLGQFGRAEKVLTINLANREQLARLTVEKLQQHLHNDGFYLQLPPKREELQVNVNK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 15596722 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | Q5QWP6 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1958308 | 1958568 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 2 | 784421 | 784699 | + | NZ_CP011040.1 | Pseudoalteromonas spongiae UST010723-006 |
| 3 | 1042132 | 1042413 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 4 | 2783494 | 2783784 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 5 | 2354712 | 2354996 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 6 | 1323665 | 1323946 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 7 | 2210904 | 2211188 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 8 | 915447 | 915728 | - | NZ_CP019959.1 | Vibrio owensii |
| 9 | 870254 | 870535 | + | NZ_CP030788.1 | Vibrio campbellii |
| 10 | 1114118 | 1114399 | + | NZ_CP009467.1 | Vibrio harveyi |
| 11 | 2747621 | 2747902 | - | NC_013456.1 | Vibrio antiquarius |
| 12 | 2011123 | 2011407 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 13 | 2389418 | 2389699 | - | NZ_AP014635.1 | Vibrio tritonius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031781.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13406.8 | 1.0 | 13 | 45 | same-strand | Transglycosylase SLT domain |
| 2 | PF01612.22 | 1.0 | 13 | 2067 | same-strand | 3'-5' exonuclease |
| 3 | PF00570.25 | 1.0 | 13 | 2067 | same-strand | HRDC domain |
| 4 | PF00501.30 | 0.92 | 12 | 3272.0 | same-strand | AMP-binding enzyme |
| 5 | PF13193.8 | 0.92 | 12 | 3272.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 6 | PF03776.16 | 0.92 | 12 | 1693.0 | opposite-strand | Septum formation topological specificity factor MinE |
| 7 | PF13614.8 | 0.92 | 12 | 878.0 | opposite-strand | AAA domain |
| 8 | PF01656.25 | 0.92 | 12 | 878.0 | opposite-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 9 | PF10609.11 | 0.92 | 12 | 878.0 | opposite-strand | NUBPL iron-transfer P-loop NTPase |
| 10 | PF03775.18 | 0.92 | 12 | 198.0 | opposite-strand | Septum formation inhibitor MinC, C-terminal domain |
| 11 | PF05209.15 | 0.92 | 12 | 198.0 | opposite-strand | Septum formation inhibitor MinC, N-terminal domain |
| 12 | PF03466.22 | 0.69 | 9 | 1092 | same-strand | LysR substrate binding domain |
| 13 | PF00126.29 | 0.69 | 9 | 1092 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 14 | PF07662.15 | 0.69 | 9 | 2275 | same-strand | Na+ dependent nucleoside transporter C-terminus |
| 15 | PF01773.22 | 0.69 | 9 | 2275 | same-strand | Na+ dependent nucleoside transporter N-terminus |
| 16 | PF07670.16 | 0.69 | 9 | 2275 | same-strand | Nucleoside recognition |
| 17 | PF02882.21 | 0.62 | 8 | 3617.0 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 18 | PF00763.25 | 0.62 | 8 | 3617.0 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
++ More..