Result : Q5QVD9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AE017340.1 |
| Organism | Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) |
| Left | 2274674 |
| Right | 2274910 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGACGAACAGAAACAGCAATCTTTCGAACAGGCTCTGGAGCAGCTAGAGCAACTGGTTAATGAACTGGAACAAGGCGACTTACCGCTTGAGCAATCGCTGAAAAAATTCGAACAAGCCATTGCCTTGTCACGTTCCAGCCAGCAACAATTGCAGCAGGCTGAGCAAAAAGTGACAACTTTGTTGGCTGAACAGCAATCTGGAAATGATGAAAGCAATGGAGAACTGATGTGA |
| Sequence | MADEQKQQSFEQALEQLEQLVNELEQGDLPLEQSLKKFEQAIALSRSSQQQLQQAEQKVTTLLAEQQSGNDESNGELM |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 15596722 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q5QVD9 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2274674 | 2274910 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 2 | 2774207 | 2774449 | + | NZ_CP046670.1 | Alteromonas mediterranea |
| 3 | 1473353 | 1473595 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 4 | 2928818 | 2929060 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 5 | 742501 | 742743 | - | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 6 | 803902 | 804144 | - | NZ_CP011030.1 | Pseudoalteromonas issachenkonii |
| 7 | 817048 | 817290 | - | NZ_CP033065.1 | Pseudoalteromonas agarivorans |
| 8 | 2846508 | 2846750 | + | NZ_CP023464.1 | Pseudoalteromonas atlantica |
| 9 | 3078341 | 3078583 | + | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 10 | 866292 | 866534 | - | NZ_CP011028.1 | Pseudoalteromonas espejiana DSM 9414 |
| 11 | 2509856 | 2510098 | + | NC_007481.1 | Pseudoalteromonas translucida |
| 12 | 2782736 | 2782978 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 13 | 2889428 | 2889670 | + | NZ_CP027523.1 | Pseudoalteromonas carrageenovora |
| 14 | 2021683 | 2021877 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 15 | 1061224 | 1061466 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 16 | 1978526 | 1978747 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 17 | 2766942 | 2767184 | + | NZ_CP008849.1 | Alteromonas australica |
| 18 | 3992776 | 3993024 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 19 | 1031231 | 1031482 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 20 | 4097506 | 4097742 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 21 | 7121599 | 7121802 | - | NZ_CP061800.1 | Desulfonema magnum |
| 22 | 3181896 | 3182141 | + | NZ_CP021434.1 | Tumebacillus avium |
| 23 | 606050 | 606301 | - | NZ_CP040449.1 | Aeromonas simiae |
| 24 | 2010158 | 2010406 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 25 | 1294288 | 1294533 | + | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 26 | 3334526 | 3334744 | - | NZ_CP041660.1 | Catenovulum sediminis |
| 27 | 966005 | 966205 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 28 | 2211871 | 2212116 | + | NZ_CP007445.1 | Gilliamella apicola |
| 29 | 2817656 | 2817898 | + | NZ_CP032090.1 | Pseudoalteromonas donghaensis |
| 30 | 3016994 | 3017236 | - | NZ_CP053416.1 | Salmonella bongori |
| 31 | 2574283 | 2574501 | + | NC_011753.2 | Vibrio atlanticus |
| 32 | 2541387 | 2541629 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 33 | 3087493 | 3087693 | + | NZ_CP038853.1 | Pantoea vagans |
| 34 | 3351201 | 3351434 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 35 | 4152839 | 4153090 | - | NZ_CP044060.1 | Aeromonas veronii |
| 36 | 2619450 | 2619701 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 37 | 3427070 | 3427312 | + | NZ_CP050150.1 | Hafnia alvei |
| 38 | 1195375 | 1195617 | - | NZ_CP061511.1 | Mixta calida |
| 39 | 2555111 | 2555302 | + | NZ_AP014635.1 | Vibrio tritonius |
| 40 | 2829897 | 2830139 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 41 | 3152395 | 3152595 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 42 | 3449800 | 3450048 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 43 | 4012269 | 4012523 | - | NZ_CP009787.1 | Yersinia rohdei |
| 44 | 4250334 | 4250567 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 45 | 3829005 | 3829238 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 46 | 2301127 | 2301327 | - | NZ_CP026364.1 | Proteus hauseri |
| 47 | 477417 | 477659 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 48 | 5305116 | 5305352 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 49 | 1748560 | 1748790 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 50 | 2460916 | 2461161 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 51 | 2104130 | 2104363 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 52 | 2887301 | 2887540 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 53 | 1050494 | 1050712 | - | NZ_CP065534.1 | Lonsdalea populi |
| 54 | 1599116 | 1599355 | - | NZ_CP046378.1 | Shewanella algae |
| 55 | 3588824 | 3589057 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 56 | 2589027 | 2589293 | - | NZ_CP065640.1 | Serratia rubidaea |
| 57 | 2168984 | 2169220 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 58 | 1433559 | 1433822 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 59 | 2414330 | 2414572 | + | NZ_CP067057.1 | Rahnella aceris |
| 60 | 684489 | 684737 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 61 | 3749508 | 3749717 | + | NZ_CP028897.1 | Dongshaea marina |
| 62 | 748156 | 748398 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 63 | 2051769 | 2052011 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 64 | 1080206 | 1080460 | - | NZ_CP046293.1 | Yersinia intermedia |
| 65 | 1044345 | 1044593 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 66 | 2107652 | 2107894 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 67 | 2209906 | 2210124 | - | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 68 | 3211899 | 3212162 | - | NZ_CP011254.1 | Serratia fonticola |
| 69 | 2643851 | 2644081 | + | NZ_CP013742.1 | Legionella pneumophila |
| 70 | 366246 | 366485 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 71 | 2778067 | 2778321 | - | NZ_CP007230.1 | Yersinia similis |
| 72 | 6865345 | 6865614 | + | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 73 | 1252881 | 1253120 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 74 | 3417301 | 3417555 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 75 | 243490 | 243690 | - | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 76 | 46690 | 46905 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 77 | 1085847 | 1086098 | - | NZ_CP018804.1 | Histophilus somni |
| 78 | 2489935 | 2490177 | + | NZ_LS483470.1 | Leminorella richardii |
| 79 | 728633 | 728878 | + | NC_017856.1 | Methylophaga frappieri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006512.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 1.0 | 78 | 3 | same-strand | Polyprenyl synthetase |
| 2 | PF13292.8 | 0.91 | 71 | 953.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 0.94 | 73 | 953.5 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.94 | 73 | 953.5 | same-strand | Transketolase, C-terminal domain |
++ More..