Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YicS |
NCBI Accession ID | CP000026.1 |
Organism | Salmonella paratyphi A (strain ATCC 9150 / SARB42) |
Left | 3763685 |
Right | 3763978 |
Strand | + |
Nucleotide Sequence | ATGAAACGAAAAACGCTTCTGCTTATTGCCGCGCTTGTCGCGCTACCGGGTGTCACGTATGCCGACTCTCCGTTTAGCTCACTCCAGTCGGCGCATGAAAAAAATACGATTTTAAAGGATTTGCGCAAAATGTGTACGCCCAAAGGCGCGCTAACCGATGAAGCCTGGGAGAAAAAAATCATGGCAAGCGAGGGGAACCAGCAGCATATTCGGGAGGCGATGATCGCGATAGAGCGCAACAATCAGCATAACTACTGGCAGGCTCTCGGCAAGGTGGAATGCCCGGAGATGTAG |
Sequence | MKRKTLLLIAALVALPGVTYADSPFSSLQSAHEKNTILKDLRKMCTPKGALTDEAWEKKIMASEGNQQHIREAMIAIERNNQHNYWQALGKVECPEM |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 15531882 |
Domain | |
Functional Category | Others |
Uniprot ID | Q5PC60 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3975556 | 3975849 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1793714 | 1794007 | + | NZ_CP053416.1 | Salmonella bongori |
3 | 1314113 | 1314406 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
4 | 399401 | 399694 | + | NZ_CP045205.1 | Citrobacter telavivensis |
5 | 34675 | 34968 | - | NZ_LR134340.1 | Escherichia marmotae |
6 | 3840215 | 3840508 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
7 | 3910921 | 3911214 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
8 | 2937396 | 2937689 | - | NZ_CP057657.1 | Escherichia fergusonii |
9 | 3471408 | 3471701 | - | NZ_CP038469.1 | Citrobacter tructae |
10 | 2618537 | 2618830 | + | NZ_CP033744.1 | Citrobacter freundii |
11 | 2466547 | 2466840 | - | NZ_CP044098.1 | Citrobacter portucalensis |
12 | 4626674 | 4626967 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
13 | 4715708 | 4715944 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
14 | 3807668 | 3807961 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00232.20 | 0.62 | 8 | 1531.5 | same-strand | Glycosyl hydrolase family 1 |
2 | PF07690.18 | 0.69 | 9 | 1542.0 | opposite-strand | Major Facilitator Superfamily |