Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L21 |
NCBI Accession ID | |
Organism | Anaplasma marginale (strain St. Maries) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MFAVVEAGGKQYKVKESYVIKVELMDVSVGEKVKLDSLATFGGKKKDAVLQRQSSAVTAEVVARCRNDKIIVFKKRRRKNYRRKIGHRQELVVLRVLKVG |
Source of smORF | Swiss-Prot |
Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
Pubmed ID | 15618402 |
Domain | CDD:412347 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q5PAS7 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 541710 | 542012 | - | NC_012026.1 | Anaplasma marginale str. Florida |
2 | 513527 | 513829 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
3 | 698355 | 698654 | + | NC_013532.1 | Anaplasma centrale str. Israel |
4 | 1993153 | 1993464 | - | NZ_CP030126.1 | Indioceanicola profundi |
5 | 711106 | 711414 | - | NC_007354.1 | Ehrlichia canis str. Jake |
6 | 1896165 | 1896476 | - | NZ_CP025611.1 | Niveispirillum cyanobacteriorum |
7 | 726919 | 727218 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
8 | 540044 | 540352 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
9 | 1047482 | 1047793 | + | NZ_CP031555.1 | Thalassospira indica |
10 | 818567 | 818875 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
11 | 639522 | 639830 | - | NC_023063.1 | Ehrlichia muris AS145 |
12 | 4596312 | 4596623 | + | NZ_CP030265.1 | Skermanella pratensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01016.21 | 1.0 | 12 | 5.5 | same-strand | Ribosomal L27 protein |
2 | PF00113.24 | 0.67 | 8 | 346.0 | opposite-strand | Enolase, C-terminal TIM barrel domain |
3 | PF03952.18 | 0.67 | 8 | 346.0 | opposite-strand | Enolase, N-terminal domain |
4 | PF01018.24 | 1.0 | 12 | 1451.0 | opposite-strand | GTP1/OBG |
5 | PF01926.25 | 1.0 | 12 | 1451.0 | opposite-strand | 50S ribosome-binding GTPase |
6 | PF02421.20 | 1.0 | 12 | 1451.0 | opposite-strand | Ferrous iron transport protein B |