Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S20 |
NCBI Accession ID | |
Organism | Anaplasma marginale (strain St. Maries) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MPNHSSAKKMVRVIKERTFSNRVRKSRVRNSVKKFLAVLESKGHLEDAVTAFRAAESNIHKCVNKGVMHRNTAARKVKSLAAKLKAFDLSLQGTST |
Source of smORF | Swiss-Prot |
Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
Pubmed ID | 15618402 |
Domain | CDD:412349 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q5P9I2 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1104333 | 1104623 | - | NC_012026.1 | Anaplasma marginale str. Florida |
2 | 144852 | 145142 | + | NC_013532.1 | Anaplasma centrale str. Israel |
3 | 1151459 | 1151749 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
4 | 1448084 | 1448374 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
5 | 1135025 | 1135312 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
6 | 50131 | 50418 | - | NC_007354.1 | Ehrlichia canis str. Jake |
7 | 37284 | 37571 | - | NC_023063.1 | Ehrlichia muris AS145 |
8 | 66848 | 67135 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
9 | 2584201 | 2584467 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01553.23 | 0.78 | 7 | 126 | same-strand | Acyltransferase |
2 | PF01327.23 | 0.78 | 7 | 917 | opposite-strand | Polypeptide deformylase |
3 | PF03167.21 | 0.78 | 7 | 1713 | opposite-strand | Uracil DNA glycosylase superfamily |