Result : Q5P9I2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | |
| Organism | Anaplasma marginale (strain St. Maries) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MPNHSSAKKMVRVIKERTFSNRVRKSRVRNSVKKFLAVLESKGHLEDAVTAFRAAESNIHKCVNKGVMHRNTAARKVKSLAAKLKAFDLSLQGTST |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 15618402 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q5P9I2 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1104333 | 1104623 | - | NC_012026.1 | Anaplasma marginale str. Florida |
| 2 | 144852 | 145142 | + | NC_013532.1 | Anaplasma centrale str. Israel |
| 3 | 1151459 | 1151749 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 4 | 1448084 | 1448374 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 5 | 1135025 | 1135312 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 6 | 50131 | 50418 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 7 | 37284 | 37571 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 8 | 66848 | 67135 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 9 | 2584201 | 2584467 | + | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012026.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01553.23 | 0.78 | 7 | 126 | same-strand | Acyltransferase |
| 2 | PF01327.23 | 0.78 | 7 | 917 | opposite-strand | Polypeptide deformylase |
| 3 | PF03167.21 | 0.78 | 7 | 1713 | opposite-strand | Uracil DNA glycosylase superfamily |
++ More..