Result : Q5NNS5

Protein Information

• Protein name: DNA gyrase inhibitor YacG
• NCBI Accession ID: AE008692.2
• Organism: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
• Left: 1028789
• Right: 1028974
• Strand: -
• Nucleotide Sequence: ATGCCATCAGCAACCAGAAAAAACGCCCCTAAAGGTAAATGCCCAATATGTGGCGCGCCAACCAAAGCTGAATTTAGACCTTTTTGCAGCCGTGGCTGCCGTGATCGGGATTTGCTTAATTGGCTAGGGGATGCCTACCGTTTGCCAGTGAAAGATTTACAAGCCGAAGATGGCGATTTTGATTAA
• Sequence: MPSATRKNAPKGKCPICGAPTKAEFRPFCSRGCRDRDLLNWLGDAYRLPVKDLQAEDGDFD
• Source of smORF: Swiss-Prot
• Function: Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}.
• Pubmed ID: 15592456
• Domain: CDD:412768
• Functional Category: Metal-binding
• Uniprot ID: Q5NNS5
• ORF Length (Amino Acid): 61

Conservation Analysis

No. of Species: 6

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1028789	1028974	-	NC_006526.2	Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
2	3239837	3240031	-	NZ_CP009429.1	Sphingopyxis macrogoltabida
3	2406281	2406487	-	NZ_CP018221.1	Tardibacter chloracetimidivorans
4	1009005	1009157	+	NZ_CP041659.1	Sphingomonas xanthus
5	324500	324682	+	NC_007964.1	Nitrobacter hamburgensis X14
6	2331093	2331269	+	NZ_CP011310.1	Aurantiacibacter atlanticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_006526.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02545.16	1.0	6	966.5	same-strand	Maf-like protein
2	PF01176.21	0.83	5	1560	same-strand	Translation initiation factor 1A / IF-1