Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein FtsB |
NCBI Accession ID | AJ749949.2 |
Organism | Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) |
Left | 729005 |
Right | 729295 |
Strand | + |
Nucleotide Sequence | ATGGATATCAAATCTAACTCTTTTTTTTATATTTTCATTTCTGTAGTTTTATTACTAATAGCAATATTGCAATATGATCTGTGGTTTAGTAATACAGGCTTTATTAAGTATCAAGCACTAAAAAAATCTGTAATTAGCCAGCAAAAAGAAGTAAAGCATAAATCTCAGACTAATGTACAATTATATTCTGAAGTGGTTTCACTACGTCAAAATAGTGAGGTGCTTGAAAGCTTAGCTCGTGAGAATATGGGCCTAATCAAGCAAGGAGAGGTTTTTTATAGTGTCAAATAA |
Sequence | MDIKSNSFFYIFISVVLLLIAILQYDLWFSNTGFIKYQALKKSVISQQKEVKHKSQTNVQLYSEVVSLRQNSEVLESLARENMGLIKQGEVFYSVK |
Source of smORF | Swiss-Prot |
Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00599}. |
Pubmed ID | 15640799 |
Domain | CDD:416267 |
Functional Category | Others |
Uniprot ID | Q5NGW7 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 570988 | 571278 | + | NC_017449.1 | Francisella hispaniensis |
2 | 558755 | 559045 | + | NZ_CP022375.1 | Francisella opportunistica |
3 | 767383 | 767673 | - | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
4 | 1751812 | 1752102 | - | NC_015696.1 | Francisella salina |
5 | 1161374 | 1161664 | - | NZ_CP043552.1 | Francisella marina |
6 | 1657917 | 1658207 | - | NZ_CP022132.1 | Francisella halioticida |
7 | 670653 | 670943 | + | NZ_CP016796.1 | Francisella uliginis |
8 | 1086870 | 1087106 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
9 | 597191 | 597481 | + | NZ_CP038241.1 | Allofrancisella inopinata |
10 | 749150 | 749386 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
11 | 657396 | 657686 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
12 | 1270346 | 1270636 | - | NZ_CP021781.1 | Francisella adeliensis |
13 | 1204035 | 1204325 | + | NZ_CP009654.1 | Francisella frigiditurris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04973.14 | 0.69 | 9 | 2839.0 | same-strand | Nicotinamide mononucleotide transporter |
2 | PF06779.16 | 0.92 | 12 | 1486.5 | same-strand | Uncharacterised MFS-type transporter YbfB |
3 | PF00113.24 | 1.0 | 13 | 8 | same-strand | Enolase, C-terminal TIM barrel domain |
4 | PF03952.18 | 1.0 | 13 | 8 | same-strand | Enolase, N-terminal domain |
5 | PF01128.21 | 1.0 | 13 | -10 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
6 | PF03222.15 | 0.92 | 12 | 687.0 | opposite-strand | Tryptophan/tyrosine permease family |
7 | PF08240.14 | 0.92 | 12 | 1950.5 | opposite-strand | Alcohol dehydrogenase GroES-like domain |
8 | PF00107.28 | 0.92 | 12 | 1950.5 | opposite-strand | Zinc-binding dehydrogenase |
9 | PF00155.23 | 1.0 | 13 | 3030 | opposite-strand | Aminotransferase class I and II |
10 | PF00704.30 | 0.62 | 8 | 4652.0 | same-strand | Glycosyl hydrolases family 18 |