Result : Q5NFS4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | AJ749949.2 |
| Organism | Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) |
| Left | 1165833 |
| Right | 1166120 |
| Strand | - |
| Nucleotide Sequence | ATGCTAATAAAAAATAATGATCTTATATTTAGTTCAGTTGATAAGATAAAGTACTCTGCGCGCAGAGGTATGCTAGAGCTTGATATAATTTTAGCGCCATATTTAAATAATTGTTATATGCATGAAGATCTTGCTAATAAAAAGCTTTTTGTTGAGTTTTTGACTAGTGAAGATAGTGATATGTTTGATTGGCTTTTTAAGGGAGTTACTCCGCCACAAAGATATCAACAACTTATAGACAAAATTATCAAAGAAAAGAAAAAGTTTAATCAAACTAAATTAAAGTAG |
| Sequence | MLIKNNDLIFSSVDKIKYSARRGMLELDIILAPYLNNCYMHEDLANKKLFVEFLTSEDSDMFDWLFKGVTPPQRYQQLIDKIIKEKKKFNQTKLK |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 15640799 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q5NFS4 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1184189 | 1184476 | - | NC_017449.1 | Francisella hispaniensis |
| 2 | 1144566 | 1144853 | - | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 3 | 1195293 | 1195580 | - | NZ_CP016796.1 | Francisella uliginis |
| 4 | 1168683 | 1168970 | - | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 5 | 1096701 | 1096988 | - | NZ_CP022375.1 | Francisella opportunistica |
| 6 | 1272690 | 1272974 | + | NC_015696.1 | Francisella salina |
| 7 | 793986 | 794273 | + | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 8 | 607366 | 607650 | + | NZ_CP043552.1 | Francisella marina |
| 9 | 872383 | 872670 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 10 | 1264487 | 1264774 | - | NZ_CP022132.1 | Francisella halioticida |
| 11 | 1224475 | 1224762 | - | NZ_CP021781.1 | Francisella adeliensis |
| 12 | 644260 | 644547 | - | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 13 | 1573334 | 1573624 | - | NZ_CP009654.1 | Francisella frigiditurris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017449.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01263.22 | 0.62 | 8 | 8195.5 | same-strand | Aldose 1-epimerase |
| 2 | PF04127.17 | 0.85 | 11 | 7023 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 3 | PF02441.21 | 0.85 | 11 | 7023 | same-strand | Flavoprotein |
| 4 | PF07690.18 | 0.77 | 10 | 5829.0 | same-strand | Major Facilitator Superfamily |
| 5 | PF13520.8 | 0.77 | 10 | 4237.5 | same-strand | Amino acid permease |
| 6 | PF00171.24 | 1.0 | 13 | 17 | same-strand | Aldehyde dehydrogenase family |
| 7 | PF01619.20 | 1.0 | 13 | 17 | same-strand | Proline dehydrogenase |
| 8 | PF14850.8 | 1.0 | 13 | 17 | same-strand | DNA-binding domain of Proline dehydrogenase |
| 9 | PF18327.3 | 1.0 | 13 | 17 | same-strand | Proline utilization A proline dehydrogenase N-terminal domain |
| 10 | PF01761.22 | 1.0 | 13 | 889 | same-strand | 3-dehydroquinate synthase |
| 11 | PF13685.8 | 0.77 | 10 | 725.5 | same-strand | Iron-containing alcohol dehydrogenase |
| 12 | PF01202.24 | 0.92 | 12 | 1916.0 | same-strand | Shikimate kinase |
| 13 | PF13238.8 | 0.92 | 12 | 1916.0 | same-strand | AAA domain |
| 14 | PF00263.23 | 0.85 | 11 | 2513 | same-strand | Bacterial type II and III secretion system protein |
| 15 | PF03958.19 | 0.85 | 11 | 2630 | same-strand | Bacterial type II/III secretion system short domain |
++ More..