Result : Q5N1F0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex subunit PetM) (Cytochrome b6-f complex subunit VII) |
| NCBI Accession ID | AP008231.1 |
| Organism | Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) |
| Left | 1818134 |
| Right | 1818247 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGGAGAAATCTTTGGAACCGCGTTTCTCTTCATCGTGTTGGTGCCCGTAGGCTTGGCACTGGGAGCCTTCCTGCTGAAAGTGCAAGGCGTTCAAAAAGCCGAAAAATAA |
| Sequence | MAGEIFGTAFLFIVLVPVGLALGAFLLKVQGVQKAEK |
| Source of smORF | Swiss-Prot |
| Function | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. {ECO:0000255|HAMAP-Rule:MF_00396}. |
| Pubmed ID | 17211581 |
| Domain | CDD:183354 |
| Functional Category | Others |
| Uniprot ID | Q5N1F0 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 349289 | 349393 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 2 | 3660362 | 3660466 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 3 | 5991156 | 5991263 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 4 | 5228840 | 5228944 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 5 | 5191851 | 5191955 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 6 | 1700790 | 1700900 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 7 | 4110075 | 4110182 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 8 | 1161616 | 1161726 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
++ More..