Protein Information |
Information Type | Description |
---|---|
Protein name | Cytochrome b6-f complex subunit 5 (Cytochrome b6-f complex subunit PetG) (Cytochrome b6-f complex subunit V) |
NCBI Accession ID | CP000825.1 |
Organism | Prochlorococcus marinus (strain MIT 9215) |
Left | 1008481 |
Right | 1008600 |
Strand | + |
Nucleotide Sequence | ATGATCGAGCCTCTTCTATGTGGAATTGTTTTAGGTTTAGTTCCAATAACTCTTCTTGGATTATTCGTAAGTGCATGGAATCAATACAGAAGAGGTTCAGGGATGCTTGACATTGATTAA |
Sequence | MIEPLLCGIVLGLVPITLLGLFVSAWNQYRRGSGMLDID |
Source of smORF | Swiss-Prot |
Function | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex. {ECO:0000255|HAMAP-Rule:MF_00432}. |
Pubmed ID | 18159947 |
Domain | CDD:420034 |
Functional Category | Others |
Uniprot ID | A8G5C7 |
ORF Length (Amino Acid) | 39 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1073451 | 1073570 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
2 | 3199521 | 3199634 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
3 | 893900 | 894013 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
4 | 1064923 | 1065036 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
5 | 1794837 | 1794950 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
6 | 5175550 | 5175663 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
7 | 5267428 | 5267541 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
8 | 3945083 | 3945196 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
9 | 4260871 | 4260987 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
10 | 4092245 | 4092361 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
11 | 5165141 | 5165257 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
12 | 2044745 | 2044855 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
13 | 271989 | 272108 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
14 | 857533 | 857646 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
15 | 1177730 | 1177843 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
16 | 2045586 | 2045699 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
17 | 549944 | 550066 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
18 | 4562693 | 4562809 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
19 | 2940436 | 2940552 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
20 | 2778033 | 2778149 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
21 | 2365818 | 2365919 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
22 | 2888277 | 2888393 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
23 | 3420681 | 3420797 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13442.8 | 0.65 | 15 | 224 | opposite-strand | Cytochrome C oxidase, cbb3-type, subunit III |