Result : Q5LTB3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
| NCBI Accession ID | CP000031.2 |
| Organism | Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) |
| Left | 1577451 |
| Right | 1577738 |
| Strand | - |
| Nucleotide Sequence | ATGACACTGGCGCTGGCCCCCACCGACCGCCCCTATCTGCCGCGCGGCGTGCGGCTGGTGACGGACCGGGTGCGCGGCGGCATTGTGTTGCTGGCGCCGGAAAAGGCGGTGGCGCTGGATGCAGTGGGCGAGGCGATCCTGTCACGAGTGGACGGGCAGACCAGCCTGGCGGCGCTGGTCGATCAGCTGGTCGAGGCCTATGACGCGCCCCGGGAACAGATCGAGCAGGACGTGCAGGCCTTTCTGCAAGGCCTGCGCGCCCGCATGTTCCTGATGGTGGCACCATGA |
| Sequence | MTLALAPTDRPYLPRGVRLVTDRVRGGIVLLAPEKAVALDAVGEAILSRVDGQTSLAALVDQLVEAYDAPREQIEQDVQAFLQGLRARMFLMVAP |
| Source of smORF | Swiss-Prot |
| Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00655}. |
| Pubmed ID | 15602564 25780504 |
| Domain | CDD:414309 |
| Functional Category | Others |
| Uniprot ID | Q5LTB3 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1577451 | 1577738 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 2 | 3799049 | 3799336 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 3 | 245195 | 245482 | + | NZ_CP032125.1 | Profundibacter amoris |
| 4 | 2859893 | 2860129 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 5 | 3269633 | 3269872 | - | NZ_CP027407.1 | Roseobacter denitrificans |
| 6 | 3734812 | 3735051 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
| 7 | 3516251 | 3516541 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
| 8 | 440344 | 440583 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 9 | 199081 | 199350 | + | NZ_CP045072.1 | Paracoccus kondratievae |
| 10 | 3259610 | 3259903 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 11 | 884573 | 884812 | - | NZ_CP024422.1 | Paracoccus yeei |
| 12 | 1300112 | 1300351 | - | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 13 | 181656 | 181928 | - | NZ_CP015090.1 | Salipiger abyssi |
| 14 | 6093608 | 6093907 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 15 | 3439330 | 3439599 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003911.12
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 15 | -3 | same-strand | Radical SAM superfamily |
| 2 | PF13186.8 | 1.0 | 15 | -3 | same-strand | Iron-sulfur cluster-binding domain |
| 3 | PF03070.18 | 0.93 | 14 | 13.5 | same-strand | TENA/THI-4/PQQC family |
| 4 | PF12706.9 | 0.93 | 14 | 789.0 | same-strand | Beta-lactamase superfamily domain |
| 5 | PF08042.13 | 1.0 | 15 | 1734.0 | same-strand | PqqA family |
| 6 | PF00072.26 | 0.73 | 11 | 2097.0 | same-strand | Response regulator receiver domain |
++ More..