Result : Q5LTB0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Coenzyme PQQ synthesis protein A (Pyrroloquinoline quinone biosynthesis protein A) |
| NCBI Accession ID | CP000031.2 |
| Organism | Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) |
| Left | 1579372 |
| Right | 1579479 |
| Strand | - |
| Nucleotide Sequence | ATGGCTTGGACGGCTCCGAAACTTCGTGAAGTGAACTGCGGCATGGAAATCAACATGTACGCCCCGGCAGAGGATGAAGGCGGTCGCGGCACCGACCCGATCCTGTAA |
| Sequence | MAWTAPKLREVNCGMEINMYAPAEDEGGRGTDPIL |
| Source of smORF | Swiss-Prot |
| Function | Required for coenzyme pyrroloquinoline quinone (PQQ) biosynthesis. PQQ is probably formed by cross-linking a specific glutamate to a specific tyrosine residue and excising these residues from the peptide. {ECO:0000255|HAMAP-Rule:MF_00656}. |
| Pubmed ID | 15602564 25780504 |
| Domain | CDD:391614 |
| Functional Category | Others |
| Uniprot ID | Q5LTB0 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1579372 | 1579479 | - | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 2 | 243419 | 243526 | + | NZ_CP032125.1 | Profundibacter amoris |
| 3 | 3391746 | 3391850 | + | NZ_CP048788.1 | Roseobacter ponti |
| 4 | 847134 | 847229 | + | NZ_CP032509.1 | Georhizobium profundi |
| 5 | 213692 | 213787 | + | NC_020560.1 | Sinorhizobium meliloti 2011 |
| 6 | 1818026 | 1818121 | - | NZ_CP041241.1 | Ensifer mexicanus |
| 7 | 432366 | 432461 | + | NZ_CP013110.1 | Sinorhizobium americanum |
| 8 | 1855304 | 1855399 | - | NZ_CP023068.1 | Ensifer sojae CCBAU 05684 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048788.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 8 | 2061.0 | same-strand | Radical SAM superfamily |
| 2 | PF13186.8 | 1.0 | 8 | 2061.0 | same-strand | Iron-sulfur cluster-binding domain |
| 3 | PF05402.14 | 1.0 | 8 | 1767.0 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 4 | PF03070.18 | 1.0 | 8 | 1000.0 | same-strand | TENA/THI-4/PQQC family |
| 5 | PF12706.9 | 1.0 | 8 | 92.0 | same-strand | Beta-lactamase superfamily domain |
| 6 | PF03466.22 | 0.62 | 5 | 412 | same-strand | LysR substrate binding domain |
| 7 | PF00126.29 | 0.62 | 5 | 412 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..