Result : Q5LLE7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CP000032.1 |
| Organism | Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) |
| Left | 75543 |
| Right | 75725 |
| Strand | + |
| Nucleotide Sequence | ATGACCTGCCCGATCTGCGGTTCCAAAACCGCTCCATCCTACCGTCCCTTCTGCTCGAAACGCTGTGCCGACCTCGACCTGGCCAAGTGGCTGAACGGCTCATACGCGATCCCGGCGAGCTCGGAAGACGAGGAAGAACCCCTTGATCAAGAGGCGGAAACTCCGGTAGCGCCGCGGCACTGA |
| Sequence | MTCPICGSKTAPSYRPFCSKRCADLDLAKWLNGSYAIPASSEDEEEPLDQEAETPVAPRH |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 15602564 25780504 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q5LLE7 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 75543 | 75725 | + | NC_006569.1 | Ruegeria pomeroyi DSS-3 |
| 2 | 3415202 | 3415384 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 3 | 1724588 | 1724770 | - | NZ_CP040818.1 | Paraoceanicella profunda |
| 4 | 395154 | 395336 | + | NZ_CP015231.1 | Epibacterium mobile F1926 |
| 5 | 561373 | 561555 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 6 | 644210 | 644392 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 7 | 3262123 | 3262308 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 8 | 3731503 | 3731706 | + | NZ_CP041159.1 | Leisingera aquaemixtae |
| 9 | 917322 | 917498 | - | NZ_CP039965.1 | Pseudorhodobacter turbinis |
| 10 | 352303 | 352500 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 11 | 1327065 | 1327247 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 12 | 2272459 | 2272641 | - | NZ_CP032125.1 | Profundibacter amoris |
| 13 | 1084126 | 1084317 | - | NZ_CP035510.1 | Haematobacter massiliensis |
| 14 | 2977685 | 2977867 | - | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 15 | 157096 | 157278 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 16 | 176619 | 176801 | + | NZ_CP010650.1 | Phaeobacter inhibens |
| 17 | 3085464 | 3085661 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 18 | 1644186 | 1644386 | - | NZ_CP060436.1 | Pseudooceanicola algae |
| 19 | 3201750 | 3201932 | - | NZ_CP016364.1 | Phaeobacter porticola |
| 20 | 2507822 | 2508019 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 21 | 3778593 | 3778790 | + | NZ_CP027407.1 | Roseobacter denitrificans |
| 22 | 1412602 | 1412793 | + | NZ_CP030918.1 | Paracoccus suum |
| 23 | 96611 | 96793 | + | NZ_CP042261.1 | Qingshengfaniella alkalisoli |
| 24 | 3039105 | 3039290 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 25 | 1026458 | 1026640 | + | NZ_CP065915.1 | Pelagovum pacificum |
| 26 | 432057 | 432248 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 27 | 1614438 | 1614620 | + | NZ_CP047045.1 | Terricaulis silvestris |
| 28 | 2568833 | 2569006 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 29 | 1868614 | 1868793 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 30 | 2467506 | 2467682 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 31 | 2842479 | 2842625 | - | NZ_CP021330.1 | Maritalea myrionectae |
| 32 | 951486 | 951653 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 33 | 2148349 | 2148516 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 34 | 461432 | 461614 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 35 | 2614480 | 2614629 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 36 | 167154 | 167330 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 37 | 4125263 | 4125445 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 38 | 481980 | 482156 | + | NZ_LR723670.1 | Pseudorhizobium flavum |
| 39 | 620996 | 621172 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 40 | 196508 | 196684 | + | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 41 | 4310434 | 4310589 | + | NZ_CP046908.1 | Stappia indica |
| 42 | 2942381 | 2942551 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006569.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01176.21 | 0.98 | 41 | 1649 | same-strand | Translation initiation factor 1A / IF-1 |
| 2 | PF02545.16 | 0.95 | 40 | 1028.0 | same-strand | Maf-like protein |
++ More..