Result : Q5LD85
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CR626927.1 |
| Organism | Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) |
| Left | 2606383 |
| Right | 2606640 |
| Strand | + |
| Nucleotide Sequence | ATGTTACTATCAGTATTATTGCAAGCTGCTGCTGCAGGAGTAGGATTAAGTAAATTGGGAGCAGCTCTCGGAGCTGGTTTAGCTGTTATCGGAGCAGGTATCGGTATTGGTAAGATCGGTGGCTCGGCCATGGAAGGTATTGCGCGTCAACCGGAGGCATCGGGAGATATCCGTATGAATATGATTATTGCCGCTGCCTTGGTTGAAGGTGTAGCGTTGTTGGCATTAGTTGTTTGTCTATTGGTACTTTTCTTATAA |
| Sequence | MLLSVLLQAAAAGVGLSKLGAALGAGLAVIGAGIGIGKIGGSAMEGIARQPEASGDIRMNMIIAAALVEGVALLALVVCLLVLFL |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 15746427 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q5LD85 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 76
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2578354 | 2578611 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 2 | 2187440 | 2187697 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 3 | 4466783 | 4467040 | + | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 4 | 1148405 | 1148662 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 5 | 3003953 | 3004210 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 6 | 1038093 | 1038350 | + | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 7 | 596419 | 596676 | - | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 8 | 1636767 | 1637021 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 9 | 253265 | 253519 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 10 | 1849582 | 1849851 | - | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 11 | 2428218 | 2428469 | - | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 12 | 1760131 | 1760391 | - | NZ_CP014766.1 | Pontibacter akesuensis |
| 13 | 2511327 | 2511587 | - | NZ_CP047984.1 | Pontibacter russatus |
| 14 | 2413864 | 2414124 | + | NZ_CP012643.1 | Rufibacter tibetensis |
| 15 | 870856 | 871128 | - | NZ_CP013909.1 | Hymenobacter sedentarius |
| 16 | 2543118 | 2543351 | - | NZ_CP047897.1 | Nibribacter ruber |
| 17 | 1105460 | 1105714 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 18 | 3172160 | 3172420 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 19 | 3567112 | 3567369 | + | NZ_CP048106.1 | Pontibacter pudoricolor |
| 20 | 311517 | 311774 | + | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 21 | 80742 | 80993 | + | NZ_CP034562.1 | Flammeovirga pectinis |
| 22 | 3469823 | 3470032 | + | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 23 | 2922572 | 2922781 | + | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 24 | 1384800 | 1385006 | - | NZ_CP055156.1 | Adhaeribacter swui |
| 25 | 381053 | 381259 | + | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 26 | 1211612 | 1211821 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 27 | 4356991 | 4357260 | - | NZ_CP037922.1 | Hymenobacter radiodurans |
| 28 | 2252925 | 2253137 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 29 | 1322950 | 1323192 | + | NZ_CP024727.1 | Prevotella intermedia |
| 30 | 1415144 | 1415383 | - | NC_014033.1 | Prevotella ruminicola 23 |
| 31 | 1549202 | 1549426 | + | NZ_LR134384.1 | Prevotella oris |
| 32 | 5191864 | 5192070 | + | NZ_CP048222.1 | Rhodocytophaga rosea |
| 33 | 3797149 | 3797406 | - | NZ_CP021235.1 | Pontibacter actiniarum |
| 34 | 2175106 | 2175345 | - | NZ_CP007451.1 | Draconibacterium orientale |
| 35 | 3077668 | 3077874 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 36 | 289788 | 290048 | - | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 37 | 1285665 | 1285922 | - | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 38 | 1332992 | 1333249 | - | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 39 | 1633453 | 1633659 | - | NZ_CP040896.1 | Hymenobacter jejuensis |
| 40 | 1295359 | 1295616 | - | NZ_CP009621.1 | Pontibacter korlensis |
| 41 | 3617687 | 3617920 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 42 | 3846625 | 3846855 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 43 | 2348883 | 2349128 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 44 | 525514 | 525744 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 45 | 9513437 | 9513667 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 46 | 6249346 | 6249624 | - | NZ_CP063458.1 | Humisphaera borealis |
| 47 | 180312 | 180575 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 48 | 3608732 | 3608971 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 49 | 1470364 | 1470576 | - | NZ_CP032819.1 | Butyricimonas faecalis |
| 50 | 2447306 | 2447536 | + | NZ_CP036291.1 | Pirellulimonas nuda |
| 51 | 1830191 | 1830400 | - | NZ_CP036289.1 | Bremerella volcania |
| 52 | 247745 | 247987 | + | NZ_CP066775.1 | Mucilaginibacter ginkgonis |
| 53 | 6788659 | 6788886 | + | NZ_CP036298.1 | Aureliella helgolandensis |
| 54 | 631474 | 631722 | + | NZ_AP023049.1 | Alistipes indistinctus |
| 55 | 3795350 | 3795604 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 56 | 4105423 | 4105677 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 57 | 1764596 | 1764850 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 58 | 6075443 | 6075706 | - | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 59 | 2276006 | 2276224 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 60 | 1170089 | 1170334 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 61 | 343941 | 344186 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 62 | 3252303 | 3252512 | + | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 63 | 2608977 | 2609228 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 64 | 651365 | 651619 | - | NZ_CP054012.1 | Parabacteroides distasonis |
| 65 | 3477700 | 3477945 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 66 | 3550880 | 3551119 | - | NZ_CP054139.1 | Mucilaginibacter mali |
| 67 | 3702179 | 3702424 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 68 | 1258408 | 1258647 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 69 | 1644669 | 1644926 | + | NZ_CP020104.1 | Spirosoma aerolatum |
| 70 | 590138 | 590365 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 71 | 9763775 | 9764029 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 72 | 942906 | 943145 | + | NZ_CP012075.1 | Prevotella fusca JCM 17724 |
| 73 | 634518 | 634730 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 74 | 1164217 | 1164453 | + | NZ_CP033896.1 | Corynebacterium choanae |
| 75 | 225275 | 225493 | + | NZ_LR134503.1 | Kaistella jeonii |
| 76 | 4569889 | 4570167 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN877293.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.88 | 67 | 1332.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 0.88 | 67 | 1332.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00119.22 | 1.0 | 76 | 65.0 | same-strand | ATP synthase A chain |
| 4 | PF00430.20 | 0.99 | 75 | 83 | same-strand | ATP synthase B/B' CF(0) |
| 5 | PF00213.20 | 0.95 | 72 | 630.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00306.29 | 0.88 | 67 | 1239 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 7 | PF00231.21 | 0.86 | 65 | 2840 | same-strand | ATP synthase |
++ More..