Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L32 |
NCBI Accession ID | CR848038.1 |
Organism | Chlamydia abortus (strain DSM 27085 / S26/3) (Chlamydophila abortus) |
Left | 905234 |
Right | 905416 |
Strand | - |
Nucleotide Sequence | ATGGCAGTACCACGCAATCGACATAGCAATGCGCGAAAAAATATCCGAAGAAGTCATCATGCAAAACAAGCACGTCATGCGGCTGTCTGTAACAACTGCAAGCAAGCTTTTATTCCTCATACAGTCTGTACTTCTTGTGGTTTTTATAACGGGAAAGCCGTTATGACTGTAGAAAAGAAATAA |
Sequence | MAVPRNRHSNARKNIRRSHHAKQARHAAVCNNCKQAFIPHTVCTSCGFYNGKAVMTVEKK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 15837807 |
Domain | CDD:415589 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q5L574 |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 932289 | 932471 | - | NC_017287.1 | Chlamydia psittaci 6BC |
2 | 931819 | 932001 | - | NC_003361.3 | Chlamydia caviae GPIC |
3 | 239031 | 239213 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
4 | 1008527 | 1008706 | + | NZ_LS398098.1 | Chlamydia suis |
5 | 196796 | 196978 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
6 | 949148 | 949327 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
7 | 228476 | 228655 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
8 | 1094468 | 1094650 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
9 | 875273 | 875455 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
10 | 440340 | 440525 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
11 | 472675 | 472869 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
12 | 1927269 | 1927451 | + | NC_015713.1 | Simkania negevensis Z |
13 | 446165 | 446356 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
14 | 325553 | 325750 | + | NZ_CP030103.1 | Mycoplasma cloacale |
15 | 1574868 | 1575050 | - | NZ_CP030126.1 | Indioceanicola profundi |
16 | 1052505 | 1052684 | + | NZ_CP017267.1 | Vagococcus teuberi |
17 | 589671 | 589844 | - | NZ_CP024962.1 | Entomoplasma freundtii |
18 | 790698 | 790880 | + | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02504.17 | 0.78 | 14 | 21.0 | same-strand | Fatty acid synthesis protein |
2 | PF10150.11 | 0.67 | 12 | 940.5 | opposite-strand | Ribonuclease E/G family |
3 | PF01553.23 | 0.67 | 12 | 2474.5 | opposite-strand | Acyltransferase |