Result : Q5KZN0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein GK1571 |
| NCBI Accession ID | BA000043.1 |
| Organism | Geobacillus kaustophilus (strain HTA426) |
| Left | 1606937 |
| Right | 1607155 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAGTCATTCTACCGTTACTTGCTGCGCTTCCGCCATGGACACCAGGAAGATCCGGTCGTCCGGTTTGCGAACGGAGCGTATGAAGACCACAGCTTTCCAAAAGGGTCGACGGACTATGAAGAACTGAGCGGCTATTTGGAGCTTAACGGTGACTATTTGGAAAGTATGGTTGTGTTTGATGAGCTATGGGAGCAATTTTTGCATGAAGCGTAA |
| Sequence | MAKSFYRYLLRFRHGHQEDPVVRFANGAYEDHSFPKGSTDYEELSGYLELNGDYLESMVVFDELWEQFLHEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 15576355 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q5KZN0 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 72
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1606937 | 1607155 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 2 | 784779 | 784997 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 3 | 2333994 | 2334212 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 4 | 1085558 | 1085776 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 5 | 1773656 | 1773874 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 6 | 1794304 | 1794522 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 7 | 1970597 | 1970815 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 8 | 1482318 | 1482536 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 9 | 2863286 | 2863504 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 10 | 3310907 | 3311107 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 3804209 | 3804430 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 12 | 3401692 | 3401892 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 1977451 | 1977651 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 2228869 | 2229069 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 15 | 2151675 | 2151875 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 16 | 2138868 | 2139068 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 17 | 2081787 | 2081987 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 18 | 2071975 | 2072172 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 19 | 3984518 | 3984718 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 20 | 2687291 | 2687494 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 21 | 2098645 | 2098845 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 22 | 2956420 | 2956647 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 23 | 1910845 | 1911069 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 24 | 2348354 | 2348551 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 25 | 2142544 | 2142744 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 26 | 307545 | 307748 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 27 | 2247170 | 2247367 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 28 | 1851955 | 1852155 | + | NZ_CP011937.1 | Bacillus velezensis |
| 29 | 4986136 | 4986354 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 30 | 2163537 | 2163761 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 31 | 3799211 | 3799402 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 32 | 3850677 | 3850895 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 33 | 1710952 | 1711155 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 34 | 2989714 | 2989941 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 35 | 2454764 | 2454985 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 36 | 281168 | 281362 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 37 | 2229384 | 2229605 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 38 | 3073106 | 3073345 | - | NZ_CP053989.1 | Niallia circulans |
| 39 | 2019234 | 2019431 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 40 | 1961368 | 1961598 | + | NZ_CP012024.1 | Bacillus smithii |
| 41 | 825189 | 825386 | - | NZ_CP019981.1 | Pediococcus inopinatus |
| 42 | 4434069 | 4434260 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 420957 | 421181 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 44 | 2027812 | 2028036 | + | NZ_LS483476.1 | Lederbergia lentus |
| 45 | 931360 | 931560 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 46 | 1038306 | 1038530 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 47 | 1449864 | 1450085 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 48 | 1796473 | 1796697 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 49 | 980034 | 980258 | + | NZ_CP024610.1 | Lactobacillus terrae |
| 50 | 798604 | 798825 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 51 | 2402922 | 2403116 | - | NZ_CP023011.2 | Enterococcus hirae |
| 52 | 1638311 | 1638550 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 53 | 1483929 | 1484165 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 54 | 927624 | 927845 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
| 55 | 658072 | 658302 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 56 | 980141 | 980371 | + | NZ_LR134483.1 | Listeria grayi |
| 57 | 964598 | 964795 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 58 | 1514954 | 1515175 | + | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 59 | 1036519 | 1036746 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 60 | 840889 | 841083 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 61 | 950251 | 950448 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 62 | 1486214 | 1486414 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 63 | 671550 | 671744 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 64 | 727372 | 727569 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 65 | 960920 | 961111 | - | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 66 | 732981 | 733172 | + | NZ_CP015247.1 | Leuconostoc suionicum |
| 67 | 909476 | 909670 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 68 | 937803 | 937994 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 69 | 1114368 | 1114562 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 70 | 1160186 | 1160383 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 71 | 1259891 | 1260088 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 72 | 1700819 | 1701019 | - | NZ_CP065211.1 | Enterococcus lactis |
++ More..