Result : Q5KWU8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein GK2553 |
| NCBI Accession ID | BA000043.1 |
| Organism | Geobacillus kaustophilus (strain HTA426) |
| Left | 2566060 |
| Right | 2566359 |
| Strand | - |
| Nucleotide Sequence | ATGGAACACGGAGACCGTCATATTACCGTTGTCGACGAACATGGCAACGAGCAGCTGTGCGAAATTTTGTTTACGTTTGAATCAGATGATTTCGGCAAATCGTATGTGTTTTACTATCCGGTCGGCGTCGAGGCGGAAGATGAAAACGGCGAGACGGAAGTGCACGTTTCCGCCTTCATCCCTGGGGATGAGAACAAAGAAGGCGAACTGCTCCCAATCGAGACGGAAGAAGAGTGGGACATGATCGAAGAAGTATGGAATACGTTTTGCGCTGAACAGGAAGAGGAAGACGACGAATAA |
| Sequence | MEHGDRHITVVDEHGNEQLCEILFTFESDDFGKSYVFYYPVGVEAEDENGETEVHVSAFIPGDENKEGELLPIETEEEWDMIEEVWNTFCAEQEEEDDE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | 15576355 |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | Q5KWU8 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 121
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2566060 | 2566359 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 2 | 3369267 | 3369566 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 3 | 1769180 | 1769479 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 4 | 1355090 | 1355389 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 5 | 716230 | 716526 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 6 | 2655922 | 2656215 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 7 | 2192886 | 2193173 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 8 | 3487361 | 3487654 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 9 | 1393041 | 1393328 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 10 | 3311646 | 3311939 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 11 | 2682455 | 2682748 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 12 | 3418854 | 3419135 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 13 | 3578999 | 3579286 | - | NZ_CP053989.1 | Niallia circulans |
| 14 | 2755135 | 2755419 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 3177972 | 3178262 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 16 | 2945838 | 2946122 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 17 | 1344626 | 1344907 | + | NZ_CP011937.1 | Bacillus velezensis |
| 18 | 3089884 | 3090168 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 19 | 2643130 | 2643411 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 20 | 2096514 | 2096795 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 21 | 3459469 | 3459756 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 2885881 | 2886162 | + | NZ_CP043404.1 | Bacillus safensis |
| 23 | 2971923 | 2972201 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 24 | 2018625 | 2018918 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 3999990 | 4000283 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 26 | 2533361 | 2533642 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 27 | 3500247 | 3500528 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 28 | 2418581 | 2418865 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 29 | 2607671 | 2607952 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 30 | 4377444 | 4377734 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 2615390 | 2615671 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 32 | 2797100 | 2797381 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 33 | 782837 | 783127 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 34 | 2680725 | 2681006 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 35 | 3416161 | 3416448 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 36 | 4362033 | 4362317 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 37 | 2629808 | 2630089 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 38 | 1257092 | 1257379 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 39 | 2576275 | 2576553 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 40 | 2569780 | 2570085 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 41 | 1477817 | 1478125 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 42 | 1637176 | 1637466 | + | NZ_LS483476.1 | Lederbergia lentus |
| 43 | 1567108 | 1567395 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 44 | 1442055 | 1442363 | + | NZ_CP016538.2 | Planococcus maritimus |
| 45 | 1451462 | 1451770 | + | NZ_CP059540.1 | Planococcus maritimus |
| 46 | 1194883 | 1195191 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 47 | 1349193 | 1349486 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 48 | 1336226 | 1336534 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 49 | 3120973 | 3121230 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 50 | 1533424 | 1533681 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 51 | 1448149 | 1448460 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 52 | 1878089 | 1878388 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 53 | 1539612 | 1539869 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 54 | 1393356 | 1393667 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 55 | 1415252 | 1415560 | + | NZ_CP016540.2 | Planococcus versutus |
| 56 | 2322315 | 2322623 | - | NZ_CP012024.1 | Bacillus smithii |
| 57 | 818775 | 819029 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 58 | 1246542 | 1246829 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 59 | 3849119 | 3849397 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 60 | 2397988 | 2398308 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 61 | 294182 | 294490 | - | NZ_CP013661.2 | Planococcus kocurii |
| 62 | 1488616 | 1488924 | + | NZ_CP019401.1 | Planococcus faecalis |
| 63 | 499833 | 500147 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 64 | 1839910 | 1840218 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 65 | 1566724 | 1567032 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 66 | 744914 | 745177 | + | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 67 | 1353865 | 1354146 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 68 | 2132597 | 2132893 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 69 | 106456 | 106707 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 70 | 1953577 | 1953885 | - | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 71 | 1321966 | 1322265 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 72 | 597374 | 597694 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 73 | 1094440 | 1094739 | + | NZ_CP023434.1 | Suicoccus acidiformans |
| 74 | 706468 | 706788 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 75 | 1194385 | 1194720 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 76 | 736406 | 736648 | + | NC_014334.2 | Lacticaseibacillus paracasei |
| 77 | 3315400 | 3315687 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 78 | 1913371 | 1913664 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 79 | 1887584 | 1887901 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 80 | 608831 | 609100 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 81 | 574184 | 574453 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 82 | 1328913 | 1329176 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 83 | 612489 | 612788 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 84 | 1508509 | 1508811 | - | NZ_LT906444.1 | Listeria welshimeri |
| 85 | 1531398 | 1531700 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 86 | 280680 | 280997 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 87 | 1445398 | 1445676 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 88 | 2164197 | 2164451 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 89 | 1526508 | 1526819 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 90 | 4362836 | 4363114 | - | NC_011725.1 | Bacillus cereus B4264 |
| 91 | 902812 | 903120 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 92 | 1941207 | 1941518 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 93 | 1265879 | 1266196 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 94 | 585304 | 585606 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 95 | 1854272 | 1854595 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 96 | 746218 | 746469 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 97 | 552936 | 553247 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 98 | 1924448 | 1924747 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 99 | 693706 | 693954 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 100 | 771352 | 771600 | + | NZ_CP065211.1 | Enterococcus lactis |
| 101 | 1768495 | 1768761 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 102 | 1116797 | 1117111 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 103 | 1354618 | 1354929 | + | NZ_CP023011.2 | Enterococcus hirae |
| 104 | 872694 | 873002 | - | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 105 | 880537 | 880794 | + | NZ_CP027563.1 | Weissella confusa |
| 106 | 23857 | 24135 | - | NZ_CP019323.1 | Companilactobacillus allii |
| 107 | 280270 | 280575 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 108 | 1885664 | 1885921 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 109 | 1909086 | 1909412 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 110 | 2649466 | 2649783 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 111 | 720856 | 721113 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 112 | 1055758 | 1056039 | - | NZ_CP014161.1 | Aerococcus urinae |
| 113 | 1955839 | 1956144 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 114 | 2557904 | 2558230 | - | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 115 | 1783908 | 1784174 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 116 | 1804246 | 1804512 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 117 | 1826567 | 1826833 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 118 | 2105874 | 2106131 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 119 | 673680 | 673985 | + | NZ_LR134293.1 | Streptococcus canis |
| 120 | 2092948 | 2093205 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 121 | 293487 | 293753 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 122 | 1317158 | 1317442 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006510.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03652.17 | 1.0 | 121 | 16.0 | same-strand | Holliday junction resolvase |
| 2 | PF06135.14 | 1.0 | 121 | 442.0 | same-strand | IreB regulatory phosphoprotein |
| 3 | PF01411.21 | 0.8 | 97 | 793.0 | same-strand | tRNA synthetases class II (A) |
| 4 | PF02272.21 | 0.8 | 97 | 793.0 | same-strand | DHHA1 domain |
| 5 | PF07973.16 | 0.8 | 97 | 793.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..