Result : Q5KWF5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein ZapA (Z ring-associated protein ZapA) |
| NCBI Accession ID | BA000043.1 |
| Organism | Geobacillus kaustophilus (strain HTA426) |
| Left | 2717225 |
| Right | 2717500 |
| Strand | - |
| Nucleotide Sequence | TTGACAGGACAGCCAAAAACGCGGGTGAGCGTCCGCATCTATGGTCAAGACTACACGATCGTCGGCGCGGAAAGCCCAGCCCATATCCGGCTCGTGGCGGCGTTCGTTGACGATAAAATGCATGAATTCAGTGAGAAAAATCCGATGCTCGATGTGCCGAAACTGGCCGTTTTGACGGCCGTCAATATTGCCAGTGAGTATTTGAAGTTAAAGGAAGAATACAACCGGCTTCGTGAACAGCTGAAGAAGGAGAAGGATGGGGAACGCGATGATTGA |
| Sequence | MTGQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKNPMLDVPKLAVLTAVNIASEYLKLKEEYNRLREQLKKEKDGERDD |
| Source of smORF | Swiss-Prot |
| Function | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division. {ECO:0000255|HAMAP-Rule:MF_02013}. |
| Pubmed ID | 15576355 |
| Domain | CDD:412769 |
| Functional Category | Others |
| Uniprot ID | Q5KWF5 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2717225 | 2717500 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 2 | 1924344 | 1924619 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 3 | 1201033 | 1201308 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 4 | 3206670 | 3206945 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 5 | 569852 | 570127 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 6 | 3639071 | 3639310 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 7 | 1231560 | 1231799 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 8 | 2348878 | 2349141 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 9 | 2160787 | 2161062 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 10 | 2824784 | 2825041 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 11 | 1068375 | 1068632 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 12 | 4498802 | 4499062 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 13 | 2830186 | 2830443 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2741423 | 2741680 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 3266187 | 3266444 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 2891329 | 2891586 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 17 | 2730640 | 2730897 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 18 | 3078110 | 3078367 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 19 | 813544 | 813813 | + | NZ_CP040336.1 | Bacillus luti |
| 20 | 4362341 | 4362610 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 21 | 4386077 | 4386346 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 4522120 | 4522389 | - | NC_011725.1 | Bacillus cereus B4264 |
| 23 | 4555882 | 4556151 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 24 | 2562224 | 2562481 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 25 | 3305174 | 3305443 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 26 | 2802538 | 2802795 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 27 | 2742626 | 2742883 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 28 | 3604782 | 3605042 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 29 | 2736074 | 2736331 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 30 | 3974887 | 3975144 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 31 | 3322249 | 3322503 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 32 | 2809115 | 2809372 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 33 | 3370886 | 3371143 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 34 | 3261008 | 3261268 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 35 | 3709327 | 3709587 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 36 | 2764988 | 2765245 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 37 | 1003395 | 1003655 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 38 | 1222637 | 1222894 | + | NZ_CP011937.1 | Bacillus velezensis |
| 39 | 2925640 | 2925897 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 40 | 3168072 | 3168332 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 41 | 2464090 | 2464362 | - | NZ_CP012024.1 | Bacillus smithii |
| 42 | 1505442 | 1505705 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 43 | 4163292 | 4163552 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 44 | 3568485 | 3568745 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 45 | 971294 | 971566 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 46 | 1362473 | 1362733 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 47 | 608226 | 608486 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 48 | 1428808 | 1429062 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 49 | 2688363 | 2688614 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 50 | 3257710 | 3257970 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 51 | 1203813 | 1204073 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 52 | 2728691 | 2728957 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 53 | 2008553 | 2008828 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 54 | 1729349 | 1729600 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 55 | 2162458 | 2162718 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 56 | 2969340 | 2969603 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 57 | 1291705 | 1291965 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 58 | 1345417 | 1345677 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 59 | 1456736 | 1456996 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 60 | 1089582 | 1089842 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 61 | 1372214 | 1372474 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 62 | 1335875 | 1336135 | + | NZ_CP016538.2 | Planococcus maritimus |
| 63 | 1347322 | 1347582 | + | NZ_CP059540.1 | Planococcus maritimus |
| 64 | 2843170 | 2843430 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 65 | 1361918 | 1362181 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 66 | 1461993 | 1462220 | + | NZ_LS483476.1 | Lederbergia lentus |
| 67 | 1390203 | 1390454 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 68 | 1260177 | 1260440 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 69 | 3226888 | 3227163 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016020.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03994.16 | 0.84 | 57 | 4765.5 | same-strand | Domain of Unknown Function (DUF350) |
| 2 | PF00488.23 | 1.0 | 68 | 2387 | same-strand | MutS domain V |
| 3 | PF01713.23 | 1.0 | 68 | 2387 | same-strand | Smr domain |
| 4 | PF14716.8 | 0.97 | 66 | 641 | same-strand | Helix-hairpin-helix domain |
| 5 | PF14791.8 | 0.96 | 65 | 640.0 | same-strand | DNA polymerase beta thumb |
| 6 | PF02674.18 | 0.99 | 67 | 6.0 | same-strand | Colicin V production protein |
| 7 | PF01351.20 | 0.93 | 63 | 133.5 | opposite-strand | Ribonuclease HII |
| 8 | PF11858.10 | 0.93 | 63 | 133.5 | opposite-strand | Domain of unknown function (DUF3378) |
| 9 | PF14520.8 | 0.94 | 64 | 641 | same-strand | Helix-hairpin-helix domain |
| 10 | PF17759.3 | 0.75 | 51 | 1295.5 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 11 | PF03483.19 | 0.75 | 51 | 1295.5 | same-strand | B3/4 domain |
| 12 | PF03147.16 | 0.75 | 51 | 1295.5 | same-strand | Ferredoxin-fold anticodon binding domain |
| 13 | PF01588.22 | 0.75 | 51 | 1295.5 | same-strand | Putative tRNA binding domain |
| 14 | PF03484.17 | 0.75 | 51 | 1295.5 | same-strand | tRNA synthetase B5 domain |
| 15 | PF01409.22 | 0.68 | 46 | 3661.0 | same-strand | tRNA synthetases class II core domain (F) |
| 16 | PF02912.20 | 0.68 | 46 | 3708 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
++ More..