| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein VraX |
| NCBI Accession ID | CP000029.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 35984 / RP62A) |
| Left | 233685 |
| Right | 233864 |
| Strand | - |
| Nucleotide Sequence | ATGATTATCTACAGAAGAAATATAGAAAATGGAACACCCGTTTATGAAATCATAACTAAAACTTTCAAGACAATTACTATAAAATGTGATGAAACTTTTAATAAGTATGAAATCTATCAATTGCTCTCTCTACTAGAGAATGACGTTGACAACATGCCGACAAGTTACTCATATCGTTAA |
| Sequence | MIIYRRNIENGTPVYEIITKTFKTITIKCDETFNKYEIYQLLSLLENDVDNMPTSYSYR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17412. Profile Description: Family of unknown function. This domain family is found in VraX proteins from Staphylococcus aureus. The vraX gene belongs to the vra operon together with the vraA gene encoding for a long chain fatty acid-CoA ligase, which is up-regulated in the VISA (vancomycin-intermediate S. aureus). The gene product, a 55-amino acids protein,is upregulated in the stress response to cell wall-active antibiotics and other surface-interactive molecules. VraX harbors a putative phosphorylation site, and could therefore be involved in regulatory processes within the cell. However, no exact function has been demonstrated. |
| Pubmed ID | 15774886 |
| Domain | CDD:407486 |
| Functional Category | Others |
| Uniprot ID | Q5HRG9 |
| ORF Length (Amino Acid) | 59 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2223780 | 2223959 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 2351069 | 2351239 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 3 | 2388522 | 2388692 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 1162159 | 1162329 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 5 | 625693 | 625881 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 6 | 303439 | 303609 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 2188560 | 2188730 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 8 | 2276947 | 2277117 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 9 | 1497559 | 1497729 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 10 | 452213 | 452383 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 11 | 2196175 | 2196345 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 12 | 2099122 | 2099295 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 13 | 2131359 | 2131532 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 14 | 1786679 | 1786852 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 15 | 589276 | 589443 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 16 | 569402 | 569569 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04241.17 | 0.81 | 13 | 3086 | opposite-strand | Protein of unknown function (DUF423) |
| 2 | PF17261.4 | 0.94 | 15 | 2699 | opposite-strand | Family of unknown function (DUF5327) |
| 3 | PF03167.21 | 1.0 | 16 | 2154.5 | opposite-strand | Uracil DNA glycosylase superfamily |
| 4 | PF08543.14 | 1.0 | 16 | 501.0 | same-strand | Phosphomethylpyrimidine kinase |
| 5 | PF00108.25 | 0.75 | 12 | 2526.0 | opposite-strand | Thiolase, N-terminal domain |
| 6 | PF02803.20 | 0.75 | 12 | 2526.0 | opposite-strand | Thiolase, C-terminal domain |
| 7 | PF07690.18 | 0.69 | 11 | 1033 | opposite-strand | Major Facilitator Superfamily |