Result : Q5HQ72
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein SERP0684 |
| NCBI Accession ID | CP000029.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 35984 / RP62A) |
| Left | 680746 |
| Right | 681024 |
| Strand | + |
| Nucleotide Sequence | ATGGAATATCAATATCCATTAGATTTAGATTGGACTAATGATGAAATGATGAAAGTAATTCATTTCTTTAATAAAATCGAAAATTATTATGAGGCATCTGTAAAAGGTGACGAAGTTTTAAATGCTTATAAAAATTTTAAACATATTGTGCCTGGAAAAGCTGATGAAAAACAGATTTTTAAAGAATTTGAAAATAAAAGTGGTTATAATAGTTACAAAGTAGTTCAAGAAATTAAAAAAAATCCAAATCAAACTTTATTTAGTAAAGATTTCGACTAA |
| Sequence | MEYQYPLDLDWTNDEMMKVIHFFNKIENYYEASVKGDEVLNAYKNFKHIVPGKADEKQIFKEFENKSGYNSYKVVQEIKKNPNQTLFSKDFD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 15774886 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q5HQ72 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1791215 | 1791493 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 1913222 | 1913491 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 3 | 1724024 | 1724299 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 4 | 2256671 | 2256946 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 405634 | 405909 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 6 | 1587529 | 1587816 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 7 | 218819 | 219091 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 8 | 1842390 | 1842662 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 9 | 1750174 | 1750452 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 10 | 769487 | 769759 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 11 | 1061967 | 1062242 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 12 | 1059287 | 1059559 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 13 | 900982 | 901260 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 14 | 1148264 | 1148542 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 15 | 680599 | 680886 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 16 | 1918698 | 1918973 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 17 | 69821 | 70093 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 18 | 1755779 | 1756057 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 19 | 1584612 | 1584836 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 20 | 1013461 | 1013736 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 21 | 1083646 | 1083918 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 22 | 849592 | 849864 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 23 | 2057444 | 2057716 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 24 | 717181 | 717453 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 25 | 697884 | 698156 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 26 | 1568408 | 1568662 | + | NZ_CP027770.1 | Staphylococcus felis |
| 27 | 1816357 | 1816629 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 28 | 792798 | 793025 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 29 | 1985648 | 1985878 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 30 | 553329 | 553601 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 1691122 | 1691394 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 32 | 1386927 | 1387202 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 33 | 2695302 | 2695571 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 34 | 643116 | 643346 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 35 | 665745 | 665978 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 36 | 496800 | 497027 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 37 | 1422700 | 1422975 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 38 | 1088342 | 1088617 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 39 | 536338 | 536592 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 40 | 2743505 | 2743774 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 41 | 1656070 | 1656321 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 42 | 661982 | 662218 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035288.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13416.8 | 0.71 | 30 | 3391.0 | same-strand | Bacterial extracellular solute-binding protein |
| 2 | PF13343.8 | 0.71 | 30 | 3391.0 | same-strand | Bacterial extracellular solute-binding protein |
| 3 | PF01547.27 | 0.74 | 31 | 3390 | same-strand | Bacterial extracellular solute-binding protein |
| 4 | PF13531.8 | 0.74 | 31 | 3390 | same-strand | Bacterial extracellular solute-binding protein |
| 5 | PF00528.24 | 0.74 | 31 | 2556 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 6 | PF00005.29 | 0.71 | 30 | 687.5 | same-strand | ABC transporter |
| 7 | PF08402.12 | 0.69 | 29 | 690 | same-strand | TOBE domain |
| 8 | PF01381.24 | 0.69 | 29 | 139 | same-strand | Helix-turn-helix |
| 9 | PF12844.9 | 0.69 | 29 | 139 | same-strand | Helix-turn-helix domain |
| 10 | PF13560.8 | 0.69 | 29 | 139 | same-strand | Helix-turn-helix domain |
| 11 | PF07992.16 | 0.83 | 35 | 173 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 12 | PF02852.24 | 0.83 | 35 | 173 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 13 | PF00070.29 | 0.83 | 35 | 173 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 14 | PF13738.8 | 0.62 | 26 | 181.5 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 15 | PF00198.25 | 0.83 | 35 | 1583 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 16 | PF00364.24 | 0.83 | 35 | 1584.0 | same-strand | Biotin-requiring enzyme |
| 17 | PF02817.19 | 0.83 | 35 | 1583 | same-strand | e3 binding domain |
| 18 | PF02780.22 | 0.76 | 32 | 3024.0 | same-strand | Transketolase, C-terminal domain |
| 19 | PF02779.26 | 0.76 | 32 | 3024.0 | same-strand | Transketolase, pyrimidine binding domain |
| 20 | PF00676.22 | 0.74 | 31 | 3991 | same-strand | Dehydrogenase E1 component |
| 21 | PF10368.11 | 0.69 | 29 | 5327 | same-strand | Putative cell-wall binding lipoprotein |
++ More..