Result : Q5HPB6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein SERP0997 |
| NCBI Accession ID | CP000029.1 |
| Organism | Staphylococcus epidermidis (strain ATCC 35984 / RP62A) |
| Left | 1014346 |
| Right | 1014570 |
| Strand | - |
| Nucleotide Sequence | ATGGTTAAGAATTATTCATTTTATCAATTTATTATGACCGTGCGCGGAAGAAAAGACGATAAAGGTGTTTTTGCTGAGCAAATTTTTGAAGACCTTGCCTTTCCAAAACACGAAGATGATTTTAATACATTATCTGAATATATTGAGACACATAGCGAATTCACCCTACCAATGTCTGTATTTGATGACTTATATGATGACTATACAGAATGGTTGAAGTTTTAA |
| Sequence | MVKNYSFYQFIMTVRGRKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSVFDDLYDDYTEWLKF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 15774886 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q5HPB6 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1453580 | 1453804 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 2 | 1513392 | 1513616 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 3 | 751494 | 751718 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 4 | 1468539 | 1468730 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 5 | 1408593 | 1408784 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 18819 | 19010 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 7 | 1367383 | 1367574 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 8 | 1914642 | 1914866 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 9 | 1433091 | 1433312 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 10 | 396814 | 397035 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 11 | 2122200 | 2122421 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 12 | 1405457 | 1405648 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 13 | 2421912 | 2422133 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 14 | 1532552 | 1532773 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 15 | 663344 | 663538 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 16 | 1205814 | 1206035 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 17 | 379445 | 379636 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 18 | 1091451 | 1091672 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 19 | 1390375 | 1390596 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 20 | 1563677 | 1563898 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 21 | 1470978 | 1471199 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 22 | 1272743 | 1272937 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 23 | 1884886 | 1885107 | - | NZ_CP027770.1 | Staphylococcus felis |
| 24 | 1228853 | 1229038 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 25 | 1322640 | 1322834 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 26 | 1306679 | 1306900 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 27 | 1497205 | 1497390 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 28 | 1059614 | 1059799 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 29 | 1221703 | 1221924 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 30 | 942027 | 942248 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 504263 | 504484 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 32 | 2358165 | 2358359 | + | NZ_CP022437.1 | Virgibacillus necropolis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00186.21 | 0.88 | 28 | 2427.0 | same-strand | Dihydrofolate reductase |
| 2 | PF02645.18 | 0.97 | 31 | 1575 | same-strand | Uncharacterised protein, DegV family COG1307 |
| 3 | PF01625.23 | 1.0 | 32 | 945.5 | same-strand | Peptide methionine sulfoxide reductase |
| 4 | PF01641.20 | 1.0 | 32 | 519.5 | same-strand | SelR domain |
| 5 | PF00358.22 | 0.97 | 31 | 0 | same-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 6 | PF03572.20 | 0.97 | 31 | 169 | same-strand | Peptidase family S41 |
| 7 | PF17820.3 | 0.97 | 31 | 169 | same-strand | PDZ domain |
| 8 | PF13180.8 | 0.97 | 31 | 169 | same-strand | PDZ domain |
| 9 | PF01471.20 | 0.97 | 31 | 169 | same-strand | Putative peptidoglycan binding domain |
| 10 | PF00595.26 | 0.97 | 31 | 169 | same-strand | PDZ domain |
| 11 | PF00583.27 | 0.91 | 29 | 1655 | same-strand | Acetyltransferase (GNAT) family |
| 12 | PF13420.9 | 0.78 | 25 | 1688 | same-strand | Acetyltransferase (GNAT) domain |
| 13 | PF03033.22 | 0.97 | 31 | 2173 | same-strand | Glycosyltransferase family 28 N-terminal domain |
| 14 | PF04101.18 | 0.97 | 31 | 2173 | same-strand | Glycosyltransferase family 28 C-terminal domain |
| 15 | PF01569.23 | 0.97 | 31 | 3262 | same-strand | PAP2 superfamily |
| 16 | PF00072.26 | 0.78 | 25 | 4338 | same-strand | Response regulator receiver domain |
| 17 | PF00486.30 | 0.78 | 25 | 4338 | same-strand | Transcriptional regulatory protein, C terminal |
++ More..