Result : Q5HHH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0337 protein SACOL0912 |
| NCBI Accession ID | CP000046.1 |
| Organism | Staphylococcus aureus (strain COL) |
| Left | 919637 |
| Right | 919831 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAATGTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCGAAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGTAACAAAGGCGAGTAA |
| Sequence | MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
| Pubmed ID | 15774886 |
| Domain | CDD:419889 |
| Functional Category | Others |
| Uniprot ID | Q5HHH4 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 816026 | 816220 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1635849 | 1636031 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 885021 | 885215 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 4 | 1700344 | 1700526 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 5 | 835184 | 835378 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 6 | 2109720 | 2109917 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 7 | 1306413 | 1306595 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 8 | 554407 | 554589 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 9 | 1910466 | 1910657 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 10 | 1500604 | 1500786 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 11 | 1212198 | 1212380 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 12 | 2064463 | 2064663 | - | NZ_CP027770.1 | Staphylococcus felis |
| 13 | 1288980 | 1289162 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 14 | 2052805 | 2052987 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 15 | 174864 | 175052 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 16 | 444915 | 445097 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 17 | 303598 | 303780 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 18 | 1259509 | 1259691 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 19 | 1939869 | 1940051 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 20 | 1401813 | 1402004 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 21 | 584480 | 584674 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 22 | 1981300 | 1981491 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 23 | 1859659 | 1859841 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 24 | 912027 | 912230 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 25 | 1435115 | 1435300 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 26 | 423740 | 423925 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 27 | 1095665 | 1095850 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 28 | 1049623 | 1049814 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 29 | 1694444 | 1694650 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 30 | 84080 | 84265 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 31 | 1902275 | 1902442 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 32 | 2034633 | 2034800 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 33 | 1399798 | 1400004 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 34 | 336188 | 336370 | + | NZ_CP047361.1 | Macrococcus canis |
| 35 | 2028982 | 2029164 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 36 | 1316263 | 1316427 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 37 | 347022 | 347210 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 38 | 1240011 | 1240196 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 39 | 1571810 | 1572022 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 40 | 2440365 | 2440556 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 41 | 3605853 | 3606023 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 42 | 2213588 | 2213755 | + | NZ_CP060716.1 | Leucobacter denitrificans |
| 43 | 1738440 | 1738643 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 44 | 563320 | 563517 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 45 | 3651741 | 3651938 | - | NZ_CP019962.1 | Eubacterium limosum |
| 46 | 1919506 | 1919706 | - | NC_014624.2 | Eubacterium callanderi |
| 47 | 316857 | 317054 | + | NZ_CP014161.1 | Aerococcus urinae |
| 48 | 1839952 | 1840140 | + | NZ_CP034549.1 | Nonlabens ponticola |
| 49 | 1761121 | 1761297 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00266.21 | 0.61 | 27 | 3323.0 | same-strand | Aminotransferase class-V |
++ More..