Result : Q5HCS0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein SACOL2649 |
| NCBI Accession ID | CP000046.1 |
| Organism | Staphylococcus aureus (strain COL) |
| Left | 2709236 |
| Right | 2709337 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAATTAGCAGTTATTTTAACATTAGTTGGCGGTTTATACTTCGCATTTAAAAAATACCAAGAACGTGTTAACCAAGCACCTAACATTGAGTACTAA |
| Sequence | MKKLAVILTLVGGLYFAFKKYQERVNQAPNIEY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 15774886 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q5HCS0 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2721168 | 2721269 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 2682464 | 2682565 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 2559091 | 2559192 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 1210594 | 1210695 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 5 | 264399 | 264500 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 6 | 1858051 | 1858152 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 7 | 365273 | 365374 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 8 | 338999 | 339100 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 9 | 613126 | 613227 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 10 | 2439493 | 2439594 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 11 | 126817 | 126918 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 12 | 1117947 | 1118048 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 13 | 1756390 | 1756491 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 14 | 262326 | 262427 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 15 | 111655 | 111756 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 16 | 2207087 | 2207188 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 17 | 14931 | 15032 | + | NZ_CP018777.1 | Staphylococcus condimenti |
++ More..