Result : Q5HBS1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | CR767821.1 |
| Organism | Ehrlichia ruminantium (strain Welgevonden) |
| Left | 442296 |
| Right | 442466 |
| Strand | + |
| Nucleotide Sequence | ATGGCATTAGGTCCTTGGCAAATTTTTTTAATTTTGGTGATAATTTTAGTTCTATTTGGAGCAGGTAAATTACCAGATGTGATGAGTGATTTAGGAAAAGGTATTCGTAACTTAAAACAAGAGTTAAAAGATAATAAATTGGCATCAACGGAAGATGAGTCAAATCTTTAG |
| Sequence | MALGPWQIFLILVIILVLFGAGKLPDVMSDLGKGIRNLKQELKDNKLASTEDESNL |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15637156 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q5HBS1 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 438095 | 438265 | + | NZ_CP040111.1 | Ehrlichia ruminantium |
| 2 | 369219 | 369389 | + | NC_007354.1 | Ehrlichia canis str. Jake |
| 3 | 317188 | 317358 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 4 | 348963 | 349133 | + | NC_012026.1 | Anaplasma marginale str. Florida |
| 5 | 892525 | 892695 | - | NC_013532.1 | Anaplasma centrale str. Israel |
| 6 | 317482 | 317652 | + | NC_023063.1 | Ehrlichia muris AS145 |
| 7 | 853217 | 853387 | - | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 8 | 1053505 | 1053675 | + | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 9 | 399748 | 399903 | + | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 10 | 398970 | 399125 | + | NZ_CP047224.1 | Neorickettsia findlayensis |
| 11 | 411282 | 411437 | + | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 12 | 935830 | 935991 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 13 | 1064977 | 1065138 | - | NC_003103.1 | Rickettsia conorii str. Malish 7 |
| 14 | 964765 | 964929 | - | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 15 | 1066231 | 1066392 | - | NC_010263.3 | Rickettsia rickettsii str. Iowa |
| 16 | 1072854 | 1073015 | - | NC_016639.1 | Rickettsia slovaca 13-B |
| 17 | 1077394 | 1077555 | - | NZ_AP019864.1 | Rickettsia heilongjiangensis |
| 18 | 393931 | 394092 | - | NC_017058.1 | Rickettsia australis str. Cutlack |
| 19 | 1109874 | 1110035 | + | NZ_AP019563.1 | Rickettsia asiatica |
| 20 | 1639203 | 1639379 | + | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 21 | 945166 | 945354 | - | NZ_CP041637.1 | Formosa sediminum |
| 22 | 3515584 | 3515760 | + | NC_015703.1 | Runella slithyformis DSM 19594 |
++ More..